Recombinant Dictyostelium discoideum Ponticulin (ponA) | CSB-YP345793DKK

(No reviews yet) Write a Review
SKU:
CSB-YP345793DKK
Availability:
25 - 35 Working Days
  • Recombinant Dictyostelium discoideum Ponticulin (ponA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Dictyostelium discoideum Ponticulin (ponA) | CSB-YP345793DKK | Cusabio

Alternative Name(s): ponA; DDB_G0293522; Ponticulin

Gene Names: ponA

Research Areas: Others

Organism: Dictyostelium discoideum (Slime mold)

AA Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-118aa

Sequence Info: Full Length of Mature Protein

MW: 11.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Reference: "F-actin affinity chromatography of detergent-solubilized plasma membranes: purification and initial characterization of ponticulin from Dictyostelium discoideum."Wuestehube L.J., Speicher D.W., Shariff A., Luna E.J.Methods Enzymol. 196:47-65(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: Ponticulin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P54660

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose