Recombinant Dictyostelium discoideum Nucleoside diphosphate kinase, cytosolic (ndkC-1) | CSB-EP326354DKK

(No reviews yet) Write a Review
SKU:
CSB-EP326354DKK
Availability:
3 - 7 Working Days
  • Recombinant Dictyostelium discoideum Nucleoside diphosphate kinase, cytosolic (ndkC-1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Dictyostelium discoideum Nucleoside diphosphate kinase, cytosolic (ndkC-1) | CSB-EP326354DKK | Cusabio

Alternative Name(s): NDK;NDP kinase

Gene Names: ndkC-1

Research Areas: Others

Organism: Dictyostelium discoideum (Slime mold)

AA Sequence: MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE

Source: E.coli

Tag Info: N-terminal 10xHis-V5-tagged

Expression Region: 1-155aa

Sequence Info: Full Length

MW: 24.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Major role in the synthesis of nucleoside triphosphates other than ATP.

Reference: "Quaternary structure of Dictyostelium discoideum nucleoside diphosphate kinase counteracts the tendency of monomers to form a molten globule." Cervoni L., Egistelli L., Mocan I., Giartosio A., Lascu I. Biochemistry 42:14599-14605(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P22887

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose