Recombinant Bacillus subtilis Subtilosin-A (sboA) | CSB-EP522484BRJ

Recombinant Bacillus subtilis Subtilosin-A (sboA) | CSB-EP522484BRJ | Cusabio

Alternative Name(s): Antilisterial bacteriocin subtilosin (sbo)

Gene Names: sboA

Research Areas: Signal Transduction

Organism: Bacillus subtilis (strain 168)

AA Sequence: NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Source: E.coli

Tag Info: Tag-Free

Expression Region: 9-43aa

Sequence Info: Full Length of Mature Protein

MW: 3.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium, A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood

Reference: "Subtilosin A, a new antibiotic peptide produced by Bacillus subtilis 168: isolation, structural analysis, and biogenesis." Babasaki K., Takao T., Shimonishi Y., Kurahashi K. J. Biochem. 98:585-603(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Bacteriocin class V family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O07623

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A