Cusabio Bacillus subtilis Recombinants
Recombinant Bacillus subtilis Endoglucanase (eglS) | CSB-EP319201BRJ
- SKU:
- CSB-EP319201BRJ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Bacillus subtilis Endoglucanase (eglS) | CSB-EP319201BRJ | Cusabio
Alternative Name(s): Carboxymethyl-cellulase;CMCase;Cellulase;Endo-1,4-beta-glucanase
Gene Names: eglS
Research Areas: Others
Organism: Bacillus subtilis (strain 168)
AA Sequence: AGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESSSALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPETPSKDKPTQENGISVQYRAGDGSMNSNQIRPQLQIKNNGNTTVDLKDVTARYWYKAKNKGQNFDCDYAQIGCGNVTHKFVTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKTTKKITLYDQGKLIWGTEPN
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal V5-tagged
Expression Region: 30-499aa
Sequence Info: Full Length of Mature Protein
MW: 59.7 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Reference: "Dissecting structure-function-stability relationships of a thermostable GH5-CBM3 cellulase from Bacillus subtilis 168." Santos C.R., Paiva J.H., Sforca M.L., Neves J.L., Navarro R.Z., Cota J., Akao P.K., Hoffmam Z.B., Meza A.N., Smetana J.H., Nogueira M.L., Polikarpov I., Xavier-Neto J., Squina F.M., Ward R.J., Ruller R., Zeri A.C., Murakami M.T. Biochem J 441:95-104(2012)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P10475
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A