Recombinant Bacillus subtilis Modification methylase BglII (bglIIM) | CSB-EP670450BRI

(No reviews yet) Write a Review
SKU:
CSB-EP670450BRI
Availability:
13 - 23 Working Days
  • Recombinant Bacillus subtilis Modification methylase BglII (bglIIM)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Bacillus subtilis Modification methylase BglII (bglIIM) | CSB-EP670450BRI | Cusabio

Alternative Name(s): N(4)- cytosine-specific methyltransferase BglII

Gene Names: bglIIM

Research Areas: Others

Organism: Bacillus subtilis (strain 168)

AA Sequence: MSEDQYKQIKLHLGMEDDNEDLPNHIPSSFPKQHLNKIYNGDTMNMLLDIPDNSVDLVVTSPPYNINKFKNDRRPLEEYLKWQTEIIEQCHRVLKPSGSIFWQVGTYVNDSGAHIPLDIRFFPIFESLGMFPRNRIVWVRPHGLHANKKFAGRHETILWFTKTPEYKFFLDPIRVPQKYANKKHYKGDKKGELSGDPLGKNPGDVWAFRNVRHNHEEDTIHPTQYPEDMIERIVLSTTEPNDIVLDPFIGMGTTASVAKNLNRYFYGAEIEKEYVDIAYQILSGEPDENNNFPNLKTLRQYCEKNGIIDPSQYTFTRQRKGSKPSLDSKAHPEEHHKKEIVERIEFEAENSVYKKVQNEQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-360aa

Sequence Info: Full Length

MW: 58 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This methylase recognizes the double-stranded sequence AGATCT, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BglII endonuclease.

Reference: Cloning and characterization of the BglII restriction-modification system reveals a possible evolutionary footprint.Anton B.P., Heiter D.F., Benner J.S., Hess E.J., Greenough L., Moran L.S., Slatko B.E., Brooks J.E.Gene 187:19-27(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This methylase recognizes the double-stranded sequence AGATCT, causes specific methylation on C-5 on both strands, and protects the DNA from cleavage by the BglII endonuclease.

Involvement in disease:

Subcellular Location:

Protein Families: N(4)/N(6)-methyltransferase family, N(4) subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q45489

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose