Recombinant Bacillus subtilis L-cystine-binding protein tcyA (tcyA) | CSB-EP331446BRJ

Recombinant Bacillus subtilis L-cystine-binding protein tcyA (tcyA) | CSB-EP331446BRJ | Cusabio

Alternative Name(s): tcyA; yckK; BSU03610; L-cystine-binding protein TcyA

Gene Names: tcyA

Research Areas: Others

Organism: Bacillus subtilis (strain 168)

AA Sequence: CGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-268aa

Sequence Info: Full Length of Mature Protein

MW: 43.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Part of the ABC transporter complex TcyABC involved in L-cystine import.

Reference: Three different systems participate in L-cystine uptake in Bacillus subtilis.Burguiere P., Auger S., Hullo M.-F., Danchin A., Martin-Verstraete I.J. Bacteriol. 186:4875-4884(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Part of the ABC transporter complex TcyABC involved in L-cystine import.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor

Protein Families: Bacterial solute-binding protein 3 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P42199

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A