Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial | CSB-EP864561BQS

Recombinant Bacillus halodurans Putative adenine deaminase BH0637 (BH0637), partial | CSB-EP864561BQS | Cusabio

Alternative Name(s): BH0637; Putative adenine deaminase BH0637; Adenase; Adenine aminase; EC 3.5.4.2

Gene Names: BH0637

Research Areas: Others

Organism: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

AA Sequence: MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-328aa

Sequence Info: Partial

MW: 57.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Complete genome sequence of the alkaliphilic bacterium Bacillus halodurans and genomic sequence comparison with Bacillus subtilis." Takami H., Nakasone K., Takaki Y., Maeno G., Sasaki R., Masui N., Fuji F., Hirama C., Nakamura Y., Ogasawara N., Kuhara S., Horikoshi K. Nucleic Acids Res. 28:4317-4331(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Metallo-dependent hydrolases superfamily, Adenine deaminase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9KF49

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A