Human Recombinant

Recombinant Human TRAF family member-associated NF-kappa-B activator (TANK), partial | CSB-YP023116HU | CusabioAlternative Name(s): TRAF-interacting protein ;I-TRAFGene Names: TANKResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA...

Recombinant Human Synapsin-1 (SYN1), partial | CSB-YP023002HU | CusabioAlternative Name(s): Brain protein 4.1Synapsin IGene Names: SYN1Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Sulfite oxidase, mitochondrial (SUOX) | CSB-YP022954HU | CusabioAlternative Name(s): EC 1.8.3.1; mitochondrial; Sulfite oxidase; Sulfite oxidase mitochondrial ; Sulfite oxidase; mitochondrial precursor; Suox; SUOX_HUMANGene Names:...

Recombinant Human Signal transducer and activator of transcription 3 (STAT3) | CSB-YP022812HU(A4) | CusabioAlternative Name(s): Acute-phase response factorGene Names: STAT3Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Serum response factor (SRF) | CSB-YP022659HU | CusabioAlternative Name(s): c fos serum response element binding factor; c fos serum response element binding transcription factor; ELK3; ERP; MCM 1; MCM1; OTTHUMP00000039820; SAP2; Serum...

Recombinant Human Small proline-rich protein 2B (SPRR2B) | CSB-YP022613HUb1 | CusabioAlternative Name(s): SPRR2B; Small proline-rich protein 2B; SPR-2BGene Names: SPRR2BResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Small proline-rich protein 2B (SPRR2B) | CSB-YP022613HU | CusabioAlternative Name(s): SPRR2B; Small proline-rich protein 2B; SPR-2BGene Names: SPRR2BResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Osteopontin (SPP1), partial | CSB-YP022603HU | CusabioAlternative Name(s): Bone sialoprotein 1Gene Names: SPP1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Suppressor of cytokine signaling 1 (SOCS1) | CSB-YP022388HU | CusabioAlternative Name(s): JAK-binding protein ;JABSTAT-induced STAT inhibitor 1 ;SSI-1Tec-interacting protein 3 ;TIP-3Gene Names: SOCS1Research Areas: ImmunologyOrganism:...

Recombinant Human Alpha-synuclein (SNCA) | CSB-YP021912HU | CusabioAlternative Name(s): Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ;NACPGene Names: SNCAResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Transcription activator BRG1 (SMARCA4), partial | CSB-YP021801HU | CusabioAlternative Name(s): ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Short name: BAF190A Mitotic growth and transcription activator Protein...

Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2), partial | CSB-YP021799HU | CusabioAlternative Name(s): ATP-dependent helicase SMAR;CA2BRG1-associated factor 190B ;BAF190BProtein brahma homologGene Names: SMARCA2Research Areas:...

Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) | CSB-YP021784HU | CusabioAlternative Name(s): ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name: ANUPGene Names: SLURP1Research Areas: CardiovascularOrganism:...

Recombinant Human Solute carrier organic anion transporter family member 2B1 (SLCO2B1), partial | CSB-YP021746HUf3 | CusabioAlternative Name(s): Organic anion transporter B (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2)...

Recombinant Human Solute carrier organic anion transporter family member 2B1 (SLCO2B1), partial | CSB-YP021746HU | CusabioAlternative Name(s): Organic anion transporter B (OATP-B) (Organic anion transporter polypeptide-related protein 2) (OATP-RP2)...

Recombinant Human Sodium/calcium exchanger 1 (SLC8A1), partial | CSB-YP021723HU | CusabioAlternative Name(s): Na(+)/Ca(2+)-exchange protein 1 Solute carrier family 8 member 1Gene Names: SLC8A1Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial | CSB-YP021581HU | CusabioAlternative Name(s): Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B ;Na(+)/Pi cotransporter 2B...

Recombinant Human Very long-chain acyl-CoA synthetase (SLC27A2), partial | CSB-YP021534HU | CusabioAlternative Name(s): Fatty acid transport protein 2 ;FATP-2Fatty-acid-coenzyme A ligase, very long-chain 1Long-chain-fatty-acid--CoA ligase (EC:6.2.1...

Recombinant Human Prestin (SLC26A5), partial | CSB-YP021528HU | CusabioAlternative Name(s): Solute carrier family 26 member 5Gene Names: SLC26A5Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Apoptosis regulatory protein Siva (SIVA1) | CSB-YP021347HU | CusabioAlternative Name(s): CD27-binding protein ;CD27BPGene Names: SIVA1Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Signal-regulatory protein gamma (SIRPG), partial | CSB-YP021338HU | CusabioAlternative Name(s): CD172 antigen-like family member B Signal-regulatory protein beta-2 Short name:SIRP-b2 Short name:SIRP-beta-2 CD_antigen: CD172gGene Names:...

Recombinant Human Signal-regulatory protein beta-1 (SIRPB1), partial | CSB-YP021335HU | CusabioAlternative Name(s): SIRP-beta-1 Alternative name(s): CD172 antigen-like family member B CD_antigen: CD172bGene Names: SIRPB1Research Areas: OthersOrganism:...

Recombinant Human Melanocyte protein PMEL (PMEL), partial | CSB-YP021324HU | CusabioAlternative Name(s): ME20-M ;ME20MMelanocyte protein Pmel 17Melanocytes lineage-specific antigen GP100Melanoma-associated ME20 antigen;P1;P100Premelanosome protein;Silver...

Recombinant Human Pulmonary surfactant-associated protein D (SFTPD) | CSB-YP021175HU | CusabioAlternative Name(s): Collectin-7 Lung surfactant protein DGene Names: SFTPDResearch Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Pulmonary surfactant-associated protein C (SFTPC) | CSB-YP021174HU | CusabioAlternative Name(s): Pulmonary surfactant-associated proteolipid SPL(Val)SP5Gene Names: SFTPCResearch Areas: TransportOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) | CSB-YP021173HU | CusabioAlternative Name(s): 18KDA pulmonary-surfactant protein 6KDA protein Pulmonary surfactant-associated proteolipid SPL(Phe)Gene Names: SFTPBResearch Areas: Cell...

Recombinant Human Plasminogen activator inhibitor 2 (SERPINB2) | CSB-YP021070HU | CusabioAlternative Name(s): Monocyte Arg-serpin (Placental plasminogen activator inhibitor) (Serpin B2) (Urokinase inhibitor PAI2) (PLANH2)Gene Names: SERPINB2Research...

Recombinant Human Corticosteroid-binding globulin (SERPINA6) | CSB-YP021062HU | CusabioAlternative Name(s): Serpin A6TranscortinGene Names: SERPINA6Research Areas: TransportOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Selenoprotein P (SEPP1) (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S) | CSB-YP021018HU | CusabioAlternative Name(s): Selenoprotein P; Selenoprotein P plasma 1; Selp; SeP; Sepp1; SEPP1_HUMANGene Names:...

Recombinant Human Semenogelin-2 (SEMG2) | CSB-YP021002HU | CusabioAlternative Name(s): Semenogelin II Short name: SGIIGene Names: SEMG2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Semaphorin-7A (SEMA7A) | CSB-YP021000HU | CusabioAlternative Name(s): CDw108 JMH blood group antigen John-Milton-Hargen human blood group Ag Semaphorin-K1 Short name: Sema K1 Semaphorin-L Short name: Sema L CD_antigen: CD108Gene Names:...

Recombinant Human S-arrestin (SAG) | CSB-YP020669HU | CusabioAlternative Name(s): 48KDA protein Retinal S-antigen Short name: S-AG Rod photoreceptor arrestinGene Names: SAGResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribonucleoside-diphosphate reductase large subunit (RRM1) | CSB-YP020518HU | CusabioAlternative Name(s): Ribonucleoside-diphosphate reductase subunit M1Ribonucleotide reductase large subunitGene Names: RRM1Research Areas: Epigenetics...

Recombinant Human 40S ribosomal protein SA (RPSA) | CSB-YP020485HU | CusabioAlternative Name(s): 37 kDa laminin receptor precursor Short name: 37LRP 37/67 kDa laminin receptor Short name: LRP/LR 67 kDa laminin receptor Short name: 67LR Colon carcinoma...

Recombinant Human 60S acidic ribosomal protein P0 (RPLP0) | CSB-YP020336HU | CusabioAlternative Name(s): 60S ribosomal protein L10EGene Names: RPLP0Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nuclear receptor ROR-alpha (RORA), Partial | CSB-YP020069HU1(F1) | CusabioAlternative Name(s): Nuclear receptor RZR-alpha (Nuclear receptor subfamily 1 group F member 1) (RAR-related orphan receptor A) (Retinoid-related orphan...

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial | CSB-YP020067HU | CusabioAlternative Name(s): Neurotrophic tyrosine kinase, receptor-related 1Gene Names: ROR1Research Areas: NeuroscienceOrganism: Homo...

Recombinant Human Ropporin-1B (ROPN1B) | CSB-YP020065HU | CusabioAlternative Name(s): Rhophilin-associated protein 1BGene Names: ROPN1BResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RING-box protein 2 (RNF7) | CSB-YP019897HU | CusabioAlternative Name(s): CKII beta-binding protein 1 ;CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene proteinGene Names: RNF7Research Areas: Epigenetics and...

Recombinant Human RING finger protein 11 (RNF11) | CSB-YP019816HU | CusabioAlternative Name(s): CGI 123; RING finger protein 11; RNF11; RNF11_HUMAN; Sid 1669; SID1669Gene Names: RNF11Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human Ribonuclease T2 (RNASET2) | CSB-YP019810HU | CusabioAlternative Name(s): Ribonuclease 6Gene Names: RNASET2Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribonuclease 4 (RNASE4) | CSB-YP019796HU | CusabioAlternative Name(s): RNS4Gene Names: RNASE4Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Replication factor C subunit 1 (RFC1), partial | CSB-YP019588HU | CusabioAlternative Name(s): Activator 1 140 kDa subunitGene Names: RFC1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Reelin (RELN), partial | CSB-YP019557HU | CusabioAlternative Name(s): LIS2; PRO1598; Reeler; Reelin; RELN; RELN_HUMAN; RLGene Names: RELNResearch Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Proto-oncogene c-Rel (REL), partial | CSB-YP019552HU | CusabioAlternative Name(s): Avian reticuloendotheliosis ; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL ; Oncogene REL avian reticuloendotheliosis; Proto-oncogene...

Recombinant Human Recoverin (RCVRN) | CSB-YP019519HU | CusabioAlternative Name(s): Cancer-associated retinopathy protein Short name: Protein CARGene Names: RCVRNResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Putative RNA-binding protein 3 (RBM3) | CSB-YP019420HU | CusabioAlternative Name(s): RNA-binding motif protein 3RNPLGene Names: RBM3Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial | CSB-YP019311HU | CusabioAlternative Name(s): 358KDA nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2Gene Names: RANBP2Research Areas:...

Recombinant Human UV excision repair protein RAD23 homolog A (RAD23A) | CSB-YP019259HU | CusabioAlternative Name(s): hHR 23A; hHR23A; HR23A; MGC111083; RAD 23a; RAD23 homolog A (S. cerevisiae); RAD23 homolog A; RAD23 yeast homolog A; RAD23A; RD23A_HUMAN;...

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT) | CSB-YP019135HU | CusabioAlternative Name(s): Glutaminyl cyclase ;QC ;sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase ;ECGene Names: QPCTResearch Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Pregnancy zone protein (PZP), partial | CSB-YP019131HU | CusabioAlternative Name(s): C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6Gene Names: PZPResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Peptide YY (PYY), partial | CSB-YP019128HU1 | CusabioAlternative Name(s): PYY-I (PYY)Gene Names: PYY Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRYSource: YeastTag Info:...

Recombinant Human Glycogen phosphorylase, liver form (PYGL), partial | CSB-YP019122HU | CusabioAlternative Name(s): Glycogen phosphorylase; Glycogen phosphorylase L; Glycogen phosphorylase liver; Glycogen phosphorylase liver form; GSD6; Hers disease;...

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial | CSB-YP019068HU | CusabioAlternative Name(s): Protein-tyrosine phosphatase receptor type Z polypeptide 1;Protein-tyrosine phosphatase receptor type Z polypeptide...

Recombinant Human Receptor-type tyrosine-protein phosphatase C (PTPRC), partial | CSB-YP019049HU | CusabioAlternative Name(s): Leukocyte common antigen ;L-CAT200; CD45Gene Names: PTPRCResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial | CSB-YP019048HU | CusabioAlternative Name(s): Vascular endothelial protein tyrosine phosphatase Short name: VE-PTPGene Names: PTPRBResearch Areas: Signal...

Recombinant Human Prothymosin alpha (PTMA) | CSB-YP019000HUb0 | CusabioAlternative Name(s): TMSAGene Names: PTMAResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Prothymosin alpha (PTMA) | CSB-YP019000HU | CusabioAlternative Name(s): TMSAGene Names: PTMAResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Prostate stem cell antigen (PSCA) | CSB-YP018840HU | CusabioAlternative Name(s): PSCA; UNQ206/PRO232; Prostate stem cell antigenGene Names: PSCAResearch Areas: Tags & Cell MarkersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Prosaposin (PSAP), partial | CSB-YP018836HU | CusabioAlternative Name(s): Proactivator polypeptideGene Names: PSAPResearch Areas: Signal TransductionOrganism: Homo sapiens (Human) AA Sequence:...

Recombinant Human Prominin-1 (PROM1), partial | CSB-YP018751HU | CusabioAlternative Name(s): Antigen AC133;Prominin-like protein 1; CD133Gene Names: PROM1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Proteoglycan 4 (PRG4), partial | CSB-YP018672HU | CusabioAlternative Name(s): Lubricin (Megakaryocyte-stimulating factor) (Superficial zone proteoglycan) (MSF) (SZP) Gene Names: Prg4Research Areas: Signal TransductionOrganism: Homo...

Recombinant Human Peroxiredoxin-1 (PRDX1) | CSB-YP018653HUa0 | CusabioAlternative Name(s): Natural killer cell-enhancing factor A Proliferation-associated gene protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2Gene Names:...

Recombinant Human Peroxiredoxin-1 (PRDX1) | CSB-YP018653HU | CusabioAlternative Name(s): Natural killer cell-enhancing factor A Proliferation-associated gene protein Thioredoxin peroxidase 2 Thioredoxin-dependent peroxide reductase 2 PAGA, PAGB,...

Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME) | CSB-YP018603HU | CusabioAlternative Name(s): Opa-interacting protein 4 ;OIP-4Preferentially expressed antigen of melanomaGene Names: PRAMEResearch Areas: ApoptosisOrganism:...

Recombinant Human Protein phosphatase 1 regulatory subunit 15A (PPP1R15A), partial | CSB-YP018528HU | CusabioAlternative Name(s): Growth arrest and DNA damage-inducible protein GADD34 Myeloid differentiation primary response protein MyD116 homologGene...

Recombinant Human Peroxisome prolifeRator-activated receptor gamma (PPARG) | CSB-YP018424HU | CusabioAlternative Name(s): Nuclear receptor subfamily 1 group C member 3Gene Names: PPARGResearch Areas: TranscriptionOrganism: Homo sapiens (Human)AA...

Recombinant Human Paraneoplastic antigen Ma2 (PNMA2), partial | CSB-YP018267HU | CusabioAlternative Name(s): 40KDA neuronal proteinOnconeuronal antigen Ma2;Paraneoplastic neuronal antigen MM2Gene Names: PNMA2Research Areas: NeuroscienceOrganism: Homo...

Recombinant Human Phospholipid transfer protein (PLTP) | CSB-YP018212HU | CusabioAlternative Name(s): Lipid transfer protein IIGene Names: PLTPResearch Areas: TransportOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Cardiac phospholamban (PLN) | CSB-YP018198HU | CusabioAlternative Name(s): Cardiac phospholamban; CMD1P; CMH18; PLB; Pln; PPLA_HUMANGene Names: PLNResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Phospholipase A2 group V (PLA2G5) | CSB-YP018103HU | CusabioAlternative Name(s): Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5Gene Names: PLA2G5Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA...

Recombinant Human Pyruvate kinase PKLR (PKLR) | CSB-YP018071HU | CusabioAlternative Name(s): Pyruvate kinase 1;Pyruvate kinase isozymes L/RR-type/L-type pyruvate kinaseRed cell/liver pyruvate kinaseGene Names: PKLRResearch Areas: MetabolismOrganism: Homo...

Recombinant Human Prolactin-inducible protein (PIP) | CSB-YP018020HU | CusabioAlternative Name(s): Gross cystic disease fluid protein 15Gene Names: PIPResearch Areas: Signal TransductionOrganism: Homo sapiens (Human) AA Sequence:...

Recombinant Human Elafin (PI3) | CSB-YP017952HU | CusabioAlternative Name(s): Elastase-specific inhibitor ;ESIPeptidase inhibitor 3 ;PI-3;Protease inhibitor WAP3Skin-derived antileukoproteinase ;SKALPWAP four-disulfide core domain protein 14Gene Names:...

Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1) | CSB-YP017942HU | CusabioAlternative Name(s): Phosphohistidine phosphatase 1;Protein janus-A homologGene Names: PHPT1Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Pterin-4-alpha-carbinolamine dehydRatase (PCBD1) | CSB-YP017514HU | CusabioAlternative Name(s): 4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alpha ;DCoH ;Dimerization cofactor of...

Recombinant Human Poly (A) -specific ribonuclease PARN (PARN) | CSB-YP017456HU | CusabioAlternative Name(s): Deadenylating nucleaseDeadenylation nucleasePolyadenylate-specific ribonucleaseGene Names: PARNResearch Areas: TranscriptionOrganism: Homo...

Recombinant Human Protein disulfide-isomerase (P4HB), partial | CSB-YP017342HUf8 | CusabioAlternative Name(s): Cellular thyroid hormone-binding protein;Prolyl 4-hydroxylase subunit betap55Gene Names: P4HBResearch Areas: CancerOrganism: Homo sapiens...

Recombinant Human Protein disulfide-isomerase (P4hb) | CSB-YP017342HU | CusabioAlternative Name(s): Cellular thyroid hormone-binding protein;Prolyl 4-hydroxylase subunit betap55Gene Names: P4hbResearch Areas: CancerOrganism: Homo sapiens (Human)AA...

Recombinant Human Oxytocin-neurophysin 1 (OXT) | CSB-YP017315HU(A4)a4 | CusabioAlternative Name(s): OcytocinGene Names: OXTResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Oxytocin-neurophysin 1 (OXT) | CSB-YP017315HU(A4) | CusabioAlternative Name(s): OcytocinGene Names: OXTResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Oxytocin-neurophysin 1 (OXT), partial | CSB-YP017315HU | CusabioAlternative Name(s): OcytocinGene Names: OXTResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Oncostatin-M (OSM), partial | CSB-YP017260HUc7 | CusabioAlternative Name(s): MGC20461; ONCM_HUMAN; Oncostatin M; Oncostatin-M; OSMGene Names: OSMResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Optineurin (OPTN) | CSB-YP016363HU | CusabioAlternative Name(s): E3-14.7K-interacting protein FIP-2 Huntingtin yeast partner L Huntingtin-interacting protein 7 Short name: HIP-7 Huntingtin-interacting protein L NEMO-related...

Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial | CSB-YP016328HU | CusabioAlternative Name(s): Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21Gene Names:...

Recombinant Human Mimecan (OGN) | CSB-YP016314HU | CusabioAlternative Name(s): OsteoglycinOsteoinductive factor ;OIFGene Names: OGNResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human N-glycosylase/DNA lyase (OGG1) | CSB-YP016313HU | CusabioAlternative Name(s): 8-oxoguanine DNA glycosylase (EC:3.2.2.-) DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18) Short name: AP lyaseGene Names: OGG1Research Areas:...

Recombinant Human 7, 8-dihydro-8-oxoguanine triphosphatase (NUDT1) | CSB-YP016154HUa0 | CusabioAlternative Name(s): 2-hydroxy-dATP diphosphatase (EC:3.6.1.56) 8-oxo-dGTPase Nucleoside diphosphate-linked moiety X motif 1 MTH1Gene Names: NUDT1Research...

Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial | CSB-YP016078HU | CusabioAlternative Name(s): Divergent of neuregulin-1 Short name: DON-1 Neural- and thymus-derived activator for ERBB kinases Short name: NTAKGene Names:...

Recombinant Human Nuclear receptor subfamily 4 group A member 2 (NR4A2) | CSB-YP016063HU | CusabioAlternative Name(s): Immediate-early response protein NOT Orphan nuclear receptor NURR1 Transcriptionally-inducible nuclear receptor NOT, NURR1, TINURGene...

Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial | CSB-YP016025HU1f3 | CusabioAlternative Name(s): Atrial natriuretic peptide clearance receptor (Atrial natriuretic peptide receptor type C) (ANP-C) (ANPR-C) (NPR-C) (ANPRC)...

Recombinant Human Atrial natriuretic peptide receptor 1 (NPR1), partial | CSB-YP016023HU | CusabioAlternative Name(s): Atrial natriuretic peptide receptor type A ;ANP-A ;ANPR-A ;NPR-AGuanylate cyclase A ;GC-AGene Names: NPR1Research Areas:...

Recombinant Human Natriuretic peptides A (NPPA) | CSB-YP016020HU | CusabioAlternative Name(s): CDD-ANF ?Cardiodilatin? ?CDD? ?Cardiodilatin-related peptide? ?CDP?Gene Names: NPPAResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neuropeptide FF receptor 2 (NPFFR2) | CSB-YP015983HU | CusabioAlternative Name(s): /Gene Names: NPFFR2Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human NPC intracellular cholesterol transporter 1 (NPC1) , partial | CSB-YP015974HUf3 | CusabioAlternative Name(s): Niemann-Pick C1 proteinGene Names: NPC1Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human NHP2-like protein 1 (NHP2L1) | CSB-YP015794HU | CusabioAlternative Name(s): High mobility group-like nuclear protein 2 homolog 1OTK27SNU13 homolog ;hSNU13U4/U6.U5 tri-snRNP 15.5KDA proteinGene Names: NHP2L1Research Areas:...

Recombinant Human Protein BEX3 (NGFRAP1) | CSB-YP015781HU | CusabioAlternative Name(s): Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death...

Recombinant Human Nestin (NES), partial | CSB-YP015713HU | CusabioAlternative Name(s): ESTM 46; FLJ 21841; FLJ21841; Intermediate filament protein; Nbla00170; nes; NEST_HUMAN; NestinGene Names: NESResearch Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Nucleolin (NCL), Partial | CSB-YP015535HU | CusabioAlternative Name(s): C23; FLJ45706; MS1116 ; NCL; Nucl; NUCL_HUMAN; Nucleolin; Protein C23Gene Names: NCLResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT), partial | CSB-YP015451HU | CusabioAlternative Name(s): FHA-HIT-interacting proteinNicotinate phosphoribosyltransferase domain-containing protein 1Gene Names: NAPRT1Research Areas:...