Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial | CSB-YP019068HU

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial | CSB-YP019068HU | Cusabio

Alternative Name(s): Protein-tyrosine phosphatase receptor type Z polypeptide 1;Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2

Gene Names: PTPRZ1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 36-300aa

Sequence Info: Partial

MW: 32.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the bryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades .

Reference: A human transmembrane protein-tyrosine-phosphatase, PTP zeta, is expressed in brain and has an N-terminal receptor domain homologous to carbonic anhydrases.Krueger N.X., Saito H.Proc. Natl. Acad. Sci. U.S.A. 89:7417-7421(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades (By similarity).

Involvement in disease:

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, Secreted

Protein Families: Protein-tyrosine phosphatase family, Receptor class 5 subfamily

Tissue Specificity: Specifically expressed in the central nervous system, where it is localized in the Purkinje cell layer of the cerebellum, the dentate gyrus, and the subependymal layer of the anterior horn of the lateral ventricle. Developmentally regulated in the brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P23471

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM