Recombinant Human Prothymosin alpha (PTMA) | CSB-YP019000HUb0

(No reviews yet) Write a Review
SKU:
CSB-YP019000HUb0
Availability:
3 - 7 Working Days
  • Recombinant Human Prothymosin alpha (PTMA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €1,406.00

Description

Recombinant Human Prothymosin alpha (PTMA) | CSB-YP019000HUb0 | Cusabio

Alternative Name(s): TMSA

Gene Names: PTMA

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-111aa

Sequence Info: Full Length

MW: 14.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.

Reference: "The human prothymosin alpha gene is polymorphic and induced upon growth stimulation: evidence using a cloned cDNA." Eschenfeldt W.H., Berger S.L. Proc. Natl. Acad. Sci. U.S.A. 83:9403-9407(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Pro/parathymosin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06454

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose