E.coli Recombinant

Recombinant Human Integrin beta-7 (ITGB7), partial | CSB-EP011891HU1 | CusabioAlternative Name(s): Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to...

Recombinant Rat Integrin beta-1 (Itgb1) , partial | CSB-EP011880RA | CusabioAlternative Name(s): Beta oligodendroglia ;Beta OLFibronectin receptor subunit betaVLA-4 subunit beta; CD29Gene Names: Itgb1Research Areas: OthersOrganism: Rattus norvegicus...

Recombinant Mouse Integrin beta-1 (Itgb1), partial | CSB-EP011880MO | CusabioAlternative Name(s): Fibronectin receptor subunit beta VLA-4 subunit beta CD_antigen: CD29Gene Names: Itgb1Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Integrin alpha-L (Itgal), partial | CSB-EP011875MO | CusabioAlternative Name(s): CD11 antigen-like family member ALeukocyte adhesion glycoprotein LFA-1 alpha chain ;LFA-1ALeukocyte function-associated molecule 1 alpha chain;Lymphocyte...

Recombinant Bovine Ubiquitin-like protein ISG15 (ISG15) | CSB-EP011843BO | CusabioAlternative Name(s): Interferon-stimulated gene product 17 (Ubiquitin cross-reactive protein) (BoUCRP) (G1P2) (ISG17) (UCRP)Gene Names: ISG15Research Areas: Cell...

Recombinant Human Cis-aconitate decarboxylase (ACOD1) | CSB-EP011825HU | CusabioAlternative Name(s): Aconitate decarboxylase (Aconitate decarboxylase 1) (Cis-aconitic acid decarboxylase) (Immune-responsive gene 1 protein) (IRG1)Gene Names: ACOD1Research...

Recombinant Mouse Interferon regulatory factor 8 (Irf8) | CSB-EP011823MO | CusabioAlternative Name(s): Interferon consensus sequence-binding protein ;ICSBPGene Names: Irf8Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Interferon regulatory factor 7 (IRF7) | CSB-EP011822HU | CusabioAlternative Name(s): IRF-7Gene Names: IRF7Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Interferon regulatory factor 5 (Irf5) | CSB-EP011820MO | CusabioAlternative Name(s): Irf5Interferon regulatory factor 5; IRF-5Gene Names: Irf5Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3) | CSB-EP011811MO | CusabioAlternative Name(s): IL-1 receptor-associated kinase M (IRAK-M) (IRAK-3)Gene Names: Irak3Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rabbit Insulin (INS), partial | CSB-EP011742RB | CusabioAlternative Name(s): Insulin B chain;Insulin A chainGene Names: INSResearch Areas: Signal TransductionOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Horse Insulin (INS), partial | CSB-EP011742HO | CusabioAlternative Name(s): Gene Names: INSResearch Areas: Signal TransductionOrganism: Equus caballus (Horse)AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKASource: E.coliTag Info: N-terminal...

Recombinant Bovine Inhibin alpha chain (INHA) | CSB-EP011718BO | CusabioAlternative Name(s): INHA; Inhibin alpha chainGene Names: INHAResearch Areas: Signal TransductionOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Human C-X-C chemokine receptor type 2 (CXCR2), partial | CSB-EP011673HU | CusabioAlternative Name(s): CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B Short name: IL-8R B IL-8 receptor type 2 CD_antigen: CD182Gene Names:...

Recombinant Sheep Interleukin-8 (IL8) | CSB-EP011671SH | CusabioAlternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Gene Names: IL8Research Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Dog Interleukin-8 (IL8) | CSB-EP011671DO | CusabioAlternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Gene Names: IL8Research Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant chicken Interleukin-8 (CXCL8), partial | CSB-EP011671CH1e1 | CusabioAlternative Name(s): 9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1Gene Names: CXCL8Research Areas: OthersOrganism: Gallus...

Recombinant Chicken Interleukin-8 (CXCL8), partial | CSB-EP011671CH1 | CusabioAlternative Name(s): 9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1 ;EMF-1Gene Names: CXCL8Research Areas: OthersOrganism: Gallus...

Recombinant Mouse Interleukin-7 receptor subunit alpha (Il7r), partial | CSB-EP011670MO | CusabioAlternative Name(s): Short name: IL-7 receptor subunit alpha Short name: IL-7R subunit alpha Short name: IL-7R-alpha Short name: IL-7RAGene Names:...

Recombinant Bovine Interleukin-7 (IL7) | CSB-EP011669BO | CusabioAlternative Name(s): IL-7Gene Names: IL7Research Areas: ImmunologyOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Sheep Interleukin-6 (IL6) | CSB-EP011664SH | CusabioAlternative Name(s): IL6; Interleukin-6; IL-6Gene Names: IL6Research Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Sheep Interleukin-4 (IL4) | CSB-EP011659SH | CusabioAlternative Name(s): B-cell stimulatory factor 1Gene Names: IL4Research Areas: ImmunologyOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Dog Interleukin-4 (IL4) | CSB-EP011659DO | CusabioAlternative Name(s): B-cell stimulatory factor 1 ;BSF-1Lymphocyte stimulatory factor 1Gene Names: L4Research Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Pig Interleukin-33 (IL33), partial | CSB-EP011656PI | CusabioAlternative Name(s): /Gene Names: IL33Research Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...

Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial | CSB-EP011650MO1 | CusabioAlternative Name(s): High affinity IL-2 receptor subunit betap70-75; CD122Gene Names: l2rbResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rabbit Interleukin-2 (IL2) | CSB-EP011629RB | CusabioAlternative Name(s): T-cell growth factor Short name:TCGFGene Names: IL2Research Areas: OthersOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Macaca mulatta Interleukin-2 (IL2) | CSB-EP011629MOW | CusabioAlternative Name(s): T-cell growth factorGene Names: IL2Research Areas: ImmunologyOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Sheep Interleukin-1 beta (IL1B) | CSB-EP011614SH | CusabioAlternative Name(s): IL1BInterleukin-1 beta; IL-1 betaGene Names: IL1BResearch Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha (IL1A) | CSB-EP011613MOW | CusabioAlternative Name(s): Hematopoietin-1Gene Names: IL1AResearch Areas: OthersOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Rabbit IL-17A protein (Il17a) | CSB-EP011597RB | CusabioAlternative Name(s): /Gene Names: IL17AResearch Areas: OthersOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Macaca mulatta Uncharacterized protein (IL17A) | CSB-EP011597MOV | CusabioAlternative Name(s): /Gene Names: IL17AResearch Areas: OthersOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Sheep Interleukin-12 subunit beta (IL12B) | CSB-EP011587SH | CusabioAlternative Name(s): Cytotoxic lymphocyte maturation factor 40KDA subunit ;CLMF p40IL-12 subunit p40Gene Names: IL12BResearch Areas: OthersOrganism: Ovis aries (Sheep)AA...

Recombinant Mouse Interleukin-11 (Il11), Biotinylated | CSB-EP011583MO-B | CusabioAlternative Name(s): IL-11Gene Names: Il11Research Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Macaca mulatta Interleukin-10 (IL10) | CSB-EP011580MOW | CusabioAlternative Name(s): Cytokine synthesis inhibitory factorGene Names: IL10Research Areas: ImmunologyOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Mouse Zinc finger protein Helios (Ikzf2) | CSB-EP011576MO | CusabioAlternative Name(s): Ikaros family zinc finger protein 2 (Helios) (Zfpn1a2) (Znfn1a2)Gene Names: Ikzf2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB) | CSB-EP011572HU | CusabioAlternative Name(s): I-kappa-B kinase 2 (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB) (I-kappa-B-kinase beta) (IKK-B)...

Recombinant Mouse Immunoglobulin J chain (Jchain) | CSB-EP011337MO | CusabioAlternative Name(s): IgjGene Names: JchainResearch Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Insulin-like growth factor-binding protein 1 (Igfbp1) | CSB-EP011095RAa2 | CusabioAlternative Name(s): Igfbp1; Igfbp-1; Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1Gene Names: Igfbp1Research Areas:...

Recombinant Rat Insulin-like growth factor-binding protein 1 (Igfbp1) | CSB-EP011095RA | CusabioAlternative Name(s): Igfbp1; Igfbp-1; Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1Gene Names: Igfbp1Research Areas:...

Recombinant Mouse Insulin-like growth factor-binding protein 1 (Igfbp1) | CSB-EP011095MO | CusabioAlternative Name(s): Igfbp1; Igfbp-1; Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1Gene Names: Igfbp1Research Areas:...

Recombinant Mouse Insulin-like growth factor II (Igf2) | CSB-EP011088MO | CusabioAlternative Name(s): IGF-II (Multiplication-stimulating polypeptide) (Igf-2)Gene Names: Igf2Research Areas: Signal TransductionOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Bovine Interferon omega-1 (IFNW1) | CSB-EP011061BO | CusabioAlternative Name(s): IFN-omega-c1 Interferon alpha-II-1Gene Names: IFNW1Research Areas: ImmunologyOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Rat Interferon gamma (Ifng) | CSB-EP011050RA | CusabioAlternative Name(s): IfngInterferon gamma; IFN-gammaGene Names: IfngResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Marmota monax Interferon gamma (IFNG) | CSB-EP011050MQG | CusabioAlternative Name(s): Short name:IFN-gammaGene Names: IFNGResearch Areas: OthersOrganism: Marmota monax (Woodchuck)AA Sequence:...

Recombinant Mouse Interferon gamma (Ifng), partial | CSB-EP011050MO1 | CusabioAlternative Name(s): Ifng; Interferon gamma; IFN-gammaGene Names: IfngResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Goat Interferon gamma (IFNG) | CSB-EP011050GO | CusabioAlternative Name(s): /Gene Names: IFNGResearch Areas: ImmunologyOrganism: Capra hircus (Goat)AA Sequence:...

Recombinant Chicken Interferon gamma (IFNG) | CSB-EP011050CH | CusabioAlternative Name(s): IFNG; Interferon gamma; IFN-gammaGene Names: IFNGResearch Areas: OthersOrganism: Gallus gallus (Chicken)AA Sequence:...

Recombinant Mouse Interferon alpha-7 (Ifna7) | CSB-EP011043MOe1 | CusabioAlternative Name(s): IFN-alpha-7 (Ifa7)Gene Names: Ifna7Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Interferon alpha-16 (IFNA16) | CSB-EP011036HU | CusabioAlternative Name(s): IFN-alpha-16;Interferon alpha-WAGene Names: IFNA16Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Isocitrate dehydrogenase [NADP] Cytoplasmic domain (Idh1), partial | CSB-EP010989MO | CusabioAlternative Name(s): Cytosolic NADP-isocitrate dehydrogenaseIDPNADP(+)-specific ICDHOxalosuccinate decarboxylaseGene Names: Idh1Research Areas:...

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial | CSB-EP010883HU2 | CusabioAlternative Name(s): 5-hydroxytryptamine receptor 1D(5-HT-1D)(5-HT1D)(Serotonin 1D alpha receptor)(5-HT-1D-alpha)(Serotonin receptor 1D)Gene Names:...

Recombinant Mouse Endoplasmic reticulum chaperone BiP (Hspa5) | CSB-EP010827MO | CusabioAlternative Name(s): 78 kDa glucose-regulated protein (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein...

Recombinant Mouse Heat shock 70KDA protein 1B (Hspa1b) | CSB-EP010822MO | CusabioAlternative Name(s): Heat shock 70KDA protein 1 Short name: HSP70.1Gene Names: Hspa1bResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5--4-isomerase type 1 (HSD3B1), partial | CSB-EP010781HU1 | CusabioAlternative Name(s): 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type IGene Names: HSD3B1Research Areas:...

Recombinant Rat Hemopexin (Hpx) | CSB-EP010723RA | CusabioAlternative Name(s): Hpx; HemopexinGene Names: HpxResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Heparanase (Hpse), partial | CSB-EP010716RA | CusabioAlternative Name(s): Endo-glucoronidase (Hep)Gene Names: HpseResearch Areas: CancerOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Heterogeneous nuclear ribonucleoprotein A3 (HNRNPA3) | CSB-EP010603HU | CusabioAlternative Name(s): hnRNP A3(HNRPA3)Gene Names: HNRNPA3Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1) | CSB-EP010602MOb3 | CusabioAlternative Name(s): hnRNP A2/B1Gene Names: Hnrnpa2b1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1) | CSB-EP010602MOb0 | CusabioAlternative Name(s): hnRNP A2/B1 (Hnrpa2b1)Gene Names: Hnrnpa2b1Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus(Mouse)AA...

Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1) | CSB-EP010602MO | CusabioAlternative Name(s): hnRNP A2/B1Gene Names: Hnrnpa2b1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Hepatocyte nuclear factor 4-alpha (HNF4A) | CSB-EP010594HU | CusabioAlternative Name(s): Nuclear receptor subfamily 2 group A member 1 (Transcription factor 14) (TCF-14) (Transcription factor HNF-4) (HNF-4-alpha) (HNF4) (NR2A1)...

Recombinant Mouse Heme oxygenase 1 (Hmox1) | CSB-EP010583MO | CusabioAlternative Name(s): P32 proteinGene Names: Hmox1Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Non-histone chromosomal protein HMG-17 (HMGN2) | CSB-EP010570HU | CusabioAlternative Name(s): High mobility group nucleosome-binding domain-containing protein 2Gene Names: HMGN2Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Mouse 3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr), partial | CSB-EP010565MO1 | CusabioAlternative Name(s): Hmgcr; 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase; EC 1.1.1.34Gene Names: HmgcrResearch Areas:...

Recombinant Mouse High mobility group protein B1 (Hmgb1) | CSB-EP010553MO | CusabioAlternative Name(s): High mobility group protein 1Gene Names: Hmgb1Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Saccharomyces cerevisiae Hexokinase-1 (HXK1), partial | CSB-EP010468SVG | CusabioAlternative Name(s): Hexokinase PIHexokinase-AGene Names: HXK1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's...

Recombinant Mouse Histone H2B type 1-M (Hist1h2bm) | CSB-EP010413MO | CusabioAlternative Name(s): H2B 291BGene Names: Hist1h2bmResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Histone H2B type 1-A (Hist1h2ba) | CSB-EP010401MO | CusabioAlternative Name(s): Histone H2B, testis (Testis-specific histone H2B) (Th2b) Gene Names: Hist1h2baResearch Areas: OthersOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Mouse Histone H1.1 (H1-1) | CSB-EP010376MO | CusabioAlternative Name(s): H1 VAR.3Histone H1a ;H1aGene Names: H1-1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Orexin receptor type 1 (HCRTR1), partial | CSB-EP010231HU1 | CusabioAlternative Name(s): Hypocretin receptor type 1Gene Names: HCRTR1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Cytochrome c-type heme lyase (HCCS) | CSB-EP010165HU | CusabioAlternative Name(s): Holocytochrome c-type synthaseGene Names: HCCSResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Hemoglobin subunit gamma-2 (HBG2) | CSB-EP010156HUa1 | CusabioAlternative Name(s): Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)Gene Names: HBG2Research Areas: CardiovascularOrganism: Homo sapiens...

Recombinant Human Hemoglobin subunit gamma-2 (HBG2) | CSB-EP010156HU | CusabioAlternative Name(s): Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)Gene Names: HBG2Research Areas: CardiovascularOrganism: Homo sapiens...

Recombinant Mouse Hemoglobin subunit alpha (Hba) | CSB-EP010147MO | CusabioAlternative Name(s): Alpha-globinHemoglobin alpha chainGene Names: HbaResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Hyaluronan synthase 2 (Has2), partial | CSB-EP010140MOa2 | CusabioAlternative Name(s): Hyaluronate synthase 2Hyaluronic acid synthase 2 ;HA synthase 2Gene Names: Has2Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Hyaluronan synthase 2 (Has2), partial | CSB-EP010140MO | CusabioAlternative Name(s): Hyaluronate synthase 2Hyaluronic acid synthase 2 ;HA synthase 2Gene Names: Has2Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Hyaluronan and proteoglycan link protein 4 (HAPLN4) | CSB-EP010133HU | CusabioAlternative Name(s): Brain link protein 2 (BRAL2) (KIAA1926)Gene Names: HAPLN4Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Hyaluronan and proteoglycan link protein 3 (Hapln3) | CSB-EP010132MO | CusabioAlternative Name(s): /Gene Names: Hapln3Research Areas: cell adhesionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Hyaluronan and proteoglycan link protein 3 (HAPLN3) | CSB-EP010132HU | CusabioAlternative Name(s): EXLD1Gene Names: HAPLN3Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Hyaluronan and proteoglycan link protein 2 (HAPLN2) | CSB-EP010131HU | CusabioAlternative Name(s): Brain link protein 1 (BRAL1)Gene Names: HAPLN2Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) | CSB-EP010130HU | CusabioAlternative Name(s): Cartilage-linking protein 1 Short name: Cartilage-link protein Proteoglycan link protein CRTL1Gene Names: HAPLN1Research Areas: Signal...

Recombinant Human Heart- and neural crest derivatives-expressed protein 2 (HAND2) | CSB-EP010126HU | CusabioAlternative Name(s): Class A basic helix-loop-helix protein 26Gene Names: HAND2Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo...

Recombinant Human Histone H1.0 (H1F0) | CSB-EP010087HU | CusabioAlternative Name(s): Histone H1' Histone H1(0)Gene Names: H1F0Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Granzyme K (Gzmk) | CSB-EP010084MO | CusabioAlternative Name(s): Gene Names: GzmkResearch Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Granzyme A (Gzma) | CSB-EP010081MOa0 | CusabioAlternative Name(s): Autocrine thymic lymphoma granzyme-like serine protease (CTLA-3) (Fragmentin-1) (T cell-specific serine protease 1) (TSP-1) (Ctla-3) (Ctla3) (Mtsp-1)Gene Names:...

Recombinant Mouse Granzyme A (Gzma) | CSB-EP010081MO | CusabioAlternative Name(s): Autocrine thymic lymphoma granzyme-like serine protease CTLA-3 Fragmentin-1 T cell-specific serine protease 1Gene Names: GzmaResearch Areas: Cell BiologyOrganism: Mus...

Recombinant Rat Heat-stable enterotoxin receptor (Gucy2c), partial | CSB-EP010053RA | CusabioAlternative Name(s): Guanylyl cyclase C (GC-C) (Intestinal guanylate cyclase) ( Guc2c)Gene Names: Gucy2cResearch Areas: MicrobiologyOrganism: Rattus norvegicus...

Recombinant Human Guanylate cyclase soluble subunit alpha-2 (GUCY1A2), partial | CSB-EP010049HU1 | CusabioAlternative Name(s): GCS-alpha-2Gene Names: GUCY1A2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b) | CSB-EP010048MO | CusabioAlternative Name(s): Guca2b; Guanylate cyclase activator 2B [Cleaved into: Uroguanylin; UGN)]Gene Names: Guca2bResearch Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Rat Glutathione S-transferase P (Gstp1) | CSB-EP009989RA | CusabioAlternative Name(s): Chain 7GST 7-7GST class-piGene Names: Gstp1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Glutathione S-transferase P 1 (Gstp1) | CSB-EP009989MO | CusabioAlternative Name(s): GST YF-YFGST class-piGST-piBPreadipocyte growth factorGene Names: Gstp1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Cricetulus longicaudatus Glutathione S-transferase P (GSTP1) | CSB-EP009989DXV | CusabioAlternative Name(s): GST class-piGene Names: GSTP1Research Areas: MetabolismOrganism: Cricetulus longicaudatus(Long-tailed dwarf hamster)(Chinese...

Recombinant Human Glutathione S-transferase A2 (GSTA2) | CSB-EP009971HU | CusabioAlternative Name(s): GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2Gene Names: GSTA2Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA...

Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1) | CSB-EP009970RA | CusabioAlternative Name(s): GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1 ;GST Ya1;LigandinGene Names: Gsta1Research Areas: OthersOrganism: Rattus norvegicus...

Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) | CSB-EP009963HU | CusabioAlternative Name(s): Serine/threonine-protein kinase GSK3BGene Names: GSK3BResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Gasdermin-D (GSDMD) | CSB-EP009956HU | CusabioAlternative Name(s): Gasdermin-D(Gasdermin domain-containing protein 1) [Cleaved into: Gasdermin-D, N-terminal(GSDMD-NT)(hGSDMD-NTD); Gasdermin-D, C-terminal(GSDMD-CT)(hGSDMD-CTD)]Gene...

Recombinant Human Metabotropic glutamate receptor 5 (GRM5), partial | CSB-EP009935HU | CusabioAlternative Name(s): mGluR5 (GPRC1E) (MGLUR5)Gene Names: GRM5Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial | CSB-EP009911HUb1 | CusabioAlternative Name(s): Glutamate [NMDA] receptor subunit zeta-1 (N-methyl-D-aspartate receptor subunit NR1) (NMD-R1) (GluN1) (NMDAR1)Gene Names:...

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial | CSB-EP009911HUb0 | CusabioAlternative Name(s): Glutamate [NMDA] receptor subunit zeta-1 (N-methyl-D-aspartate receptor subunit NR1) (NMD-R1) (GluN1) (NMDAR1)Gene Names:...

Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial | CSB-EP009911HU1 | CusabioAlternative Name(s): Glutamate [NMDA] receptor subunit zeta-1 (N-methyl-D-aspartate receptor subunit NR1) (NMD-R1) (GluN1) (NMDAR1)Gene Names:...