Recombinant Human Glutathione S-transferase A2 (GSTA2) | CSB-EP009971HU

Recombinant Human Glutathione S-transferase A2 (GSTA2) | CSB-EP009971HU | Cusabio

Alternative Name(s): GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2

Gene Names: GSTA2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-222aa

Sequence Info: Full Length of BC002895

MW: 52.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Reference: "The basic glutathione S-transferases from human livers are products of separate genes." Rhoads D.M., Zarlengo R.P., Tu C.-P.D. Biochem. Biophys. Res. Commun. 145:474-481(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: GST superfamily, Alpha family

Tissue Specificity: Liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09210

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM