Cusabio Human Recombinants
Recombinant Human Glutathione S-transferase A2 (GSTA2) | CSB-EP009971HU
- SKU:
- CSB-EP009971HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Glutathione S-transferase A2 (GSTA2) | CSB-EP009971HU | Cusabio
Alternative Name(s): GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2
Gene Names: GSTA2
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-222aa
Sequence Info: Full Length of BC002895
MW: 52.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Reference: "The basic glutathione S-transferases from human livers are products of separate genes." Rhoads D.M., Zarlengo R.P., Tu C.-P.D. Biochem. Biophys. Res. Commun. 145:474-481(1987)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: GST superfamily, Alpha family
Tissue Specificity: Liver.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P09210
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM