E.coli Recombinant

Recombinant Mouse Phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1) | CSB-EP018229MO | CusabioAlternative Name(s): Protein Noxa (Noxa)Gene Names: Pmaip1Research Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Plexin-B1 (PLXNB1), partial | CSB-EP018222HU2 | CusabioAlternative Name(s): Semaphorin receptor SEPGene Names: PLXNB1Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp), partial | CSB-EP018202OEI | CusabioAlternative Name(s): DM20LipophilinGene Names: plpResearch Areas: OthersOrganism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)AA Sequence:...

Recombinant Rat Urokinase plasminogen activator surface receptor (Plaur) | CSB-EP018122RA | CusabioAlternative Name(s): CD87Gene Names: PlaurResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial | CSB-EP018107MO1 | CusabioAlternative Name(s): PLA2P (PLAP) (Plap)Gene Names: PlaaResearch Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Calcium-dependent phospholipase A2 (Pla2g5) | CSB-EP018103RA | CusabioAlternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5Gene Names: Pla2g5Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA...

Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5) | CSB-EP018103MO | CusabioAlternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5Gene Names: Pla2g5Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Apis mellifera Phospholipase A2 | CSB-EP018091DNK | CusabioAlternative Name(s): Allergen Api m I (Phosphatidylcholine 2-acylhydrolase) (Allergen: Api m 1) (bvPLA2)Gene Names: N/AResearch Areas: OthersOrganism: Apis mellifera (Honeybee)AA...

Recombinant Mouse Pyruvate kinase PKM (Pkm) | CSB-EP018072MO | CusabioAlternative Name(s): Pyruvate kinase muscle isozyme Pk3,Pkm2, PykmGene Names: PkmResearch Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Pyruvate kinase isozymes R/L (Pklr) | CSB-EP018071RA | CusabioAlternative Name(s): L-PKPyruvate kinase isozymes L/RGene Names: PklrResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Polycystin-1 (PKD1), partial | CSB-EP018051HUa0 | CusabioAlternative Name(s): PC1;Autosomal dominant polycystic kidney disease 1 proteinGene Names: PKD1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Polycystin-1 (PKD1), partial | CSB-EP018051HU | CusabioAlternative Name(s): Autosomal dominant polycystic kidney disease 1 proteinGene Names: PKD1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Pituitary homeobox 3 (Pitx3) | CSB-EP018044MO | CusabioAlternative Name(s): Homeobox protein PITX3;Paired-like homeodomain transcription factor 3Gene Names: Pitx3Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Phosphatidylinositol 4, 5-bisphosphate 3-kinase catalytic subunit gamma isoform (PIK3CG), partial | CSB-EP018001HU | CusabioAlternative Name(s): PI3-kinase subunit gamma;PI3K-gamma;PI3Kgamma;PtdIns-3-kinase subunit...

Recombinant Bovine Polymeric immunoglobulin receptor (PIGR), partial | CSB-EP017981BO | CusabioAlternative Name(s): PIGR; Polymeric immunoglobulin receptor; PIgR; Poly-Ig receptor) [Cleaved into: Secretory component]Gene Names: PIGRResearch Areas:...

Recombinant Mouse Prohibitin (Phb), partial | CSB-EP017885MO3 | CusabioAlternative Name(s): B-cell receptor-associated protein 32 (BAP 32)Gene Names: PhbResearch Areas: TranscriptionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Prohibitin (Phb), partial | CSB-EP017885MO1 | CusabioAlternative Name(s): B-cell receptor-associated protein 32 (BAP 32)Gene Names: PhbResearch Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Peptidoglycan recognition protein 1 (Pglyrp1) | CSB-EP017862MO | CusabioAlternative Name(s): Cytokine tag7 (Peptidoglycan recognition protein short) (PGRP-S) (Pglyrp) (Pgrp) (Pgrps) (Tag7)Gene Names: Pglyrp1Research Areas:...

Recombinant Bovine Peptidoglycan recognition protein 1 (PGLYRP1) | CSB-EP017862BO | CusabioAlternative Name(s): Peptidoglycan recognition protein 1(Oligosaccharide-binding protein)(OBP)(Peptidoglycan recognition protein short)(PGRP-S)Gene Names:...

Recombinant Human Phosphoribosylformylglycinamidine synthase (PFAS), partial | CSB-EP017811HU | CusabioAlternative Name(s): PFAS; KIAA0361; Phosphoribosylformylglycinamidine synthase; FGAM synthase; FGAMS; EC 6.3.5.3; Formylglycinamide ribonucleotide...

Recombinant mouse platelet factor 4 (Pf4) | CSB-EP017809MO | CusabioAlternative Name(s): C-X-C motif chemokine 4Gene Names: Pf4Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Peroxisomal biogenesis factor 3 (PEX3), partial | CSB-EP017804HU1 | CusabioAlternative Name(s): Peroxin-3 ?Peroxisomal assembly protein PEX3?Gene Names: PEX3Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Pescadillo homolog (PES1) | CSB-EP017791HU | CusabioAlternative Name(s): Gene Names: PES1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Pyridoxal phosphate phosphatase (Pdxp) | CSB-EP017749MO | CusabioAlternative Name(s): PLP phosphatase Alternative name(s): ChronophinGene Names: PdxpResearch Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial (Pdk4), partial | CSB-EP017730MO | CusabioAlternative Name(s): Pyruvate dehydrogenase kinase isoform 4Gene Names: Pdk4Research Areas: MetabolismOrganism: Mus musculus...

Recombinant Human Protein disulfide-isomerase A3 (PDIA3) | CSB-EP017720HU | CusabioAlternative Name(s): 58 kDa glucose-regulated protein 58 kDa microsomal proteinGene Names: PDIA3Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Protein disulfide-isomerase A2 (Pdia2) | CSB-EP017719MO | CusabioAlternative Name(s): Pdia2; Pdip; Protein disulfide-isomerase A2; EC 5.3.4.1; PDIpGene Names: Pdia2Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Pyruvate dehydrogenase protein X component, mitochondrial (PDHX) | CSB-EP017718HUa0 | CusabioAlternative Name(s): Pyruvate dehydrogenase protein X component, mitochondrial(Dihydrolipoamide dehydrogenase-binding protein of pyruvate...

Recombinant Human Pyruvate dehydrogenase protein X component, mitochondrial (PDHX) | CSB-EP017718HU | CusabioAlternative Name(s): Pyruvate dehydrogenase protein X component, mitochondrial(Dihydrolipoamide dehydrogenase-binding protein of pyruvate...

Recombinant Human Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (PDHA1), partial | CSB-EP017715HUc0 | CusabioAlternative Name(s): Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial(EC 1.2.4...

Recombinant Human Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial (PDHA1), partial | CSB-EP017715HUb1 | CusabioAlternative Name(s): PDHE1-A type IGene Names: PDHA1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA...

Recombinant Staphylococcus aureus Peptide deformylase (def) | CSB-EP017707FKZ | CusabioAlternative Name(s): Polypeptide deformylaseGene Names: defResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Escherichia coli O157:H7 Peptide deformylase (def) | CSB-EP017707EOD | CusabioAlternative Name(s): Polypeptide deformylaseGene Names: defResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5 (Pcsk5) | CSB-EP017644MO | CusabioAlternative Name(s): Proprotein convertase 5 ;PC5Proprotein convertase 6 ;PC6Subtilisin-like proprotein convertase 6 ;SPC6Subtilisin/kexin-like protease...

Recombinant Rat Neuroendocrine convertase 2 (Pcsk2) | CSB-EP017642RA | CusabioAlternative Name(s): NEC 2 Alternative name(s): KEX2-like endoprotease 2 Prohormone convertase 2 Proprotein convertase 2 Short name: PC2Gene Names: Pcsk2Research Areas: Signal...

Recombinant Mouse Calmodulin regulator protein PCP4 (Pcp4) | CSB-EP017636MO | CusabioAlternative Name(s): Brain-specific antigen PCP-4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)Gene Names: Pcp4Research Areas: Cell BiologyOrganism: Mus...

Recombinant Mouse Pericentrin (Pcnt), partial | CSB-EP017627MO | CusabioAlternative Name(s): Pcnt2Gene Names: PcntResearch Areas: Tags & Cell MarkersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Saccharomyces cerevisiae Proliferating cell nuclear antigen (POL30) | CSB-EP017621SVG | CusabioAlternative Name(s): PCNAGene Names: POL30Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)AA...

Recombinant Human Prolyl 4-hydroxylase subunit alpha-1 (P4HA1) | CSB-EP017339HU | CusabioAlternative Name(s): Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1 (P4HA)Gene Names: P4HA1Research Areas: Signal TransductionOrganism: Homo...

Recombinant Mouse Oxytocin-neurophysin 1 (Oxt), partial | CSB-EP017315MO | CusabioAlternative Name(s): OT-NPI (Ocytocin)Gene Names: OxtResearch Areas: NeuroscienceOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Mouse Homeobox protein OTX2 (Otx2) | CSB-EP017299MO | CusabioAlternative Name(s): Orthodenticle homolog 2 (Otx-2)Gene Names: Otx2Research Areas: Developmental BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Ornithine carbamoyltransferase, mitochondrial (Otc) | CSB-EP017270MO | CusabioAlternative Name(s): Ornithine transcarbamylase ;OTCaseGene Names: OtcResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Osteocrin (Ostn), partial | CSB-EP017269RA | CusabioAlternative Name(s): MusclinGene Names: OstnResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence: SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSRSource: E.coliTag Info:...

Recombinant Human Oncostatin-M (OSM) | CSB-EP017260HU1 | CusabioAlternative Name(s): Short name:OSMGene Names: OSMResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Gorilla gorilla gorilla Orosomucoid 2 (ORM2) | CSB-EP017237GGZ | CusabioAlternative Name(s): /Gene Names: ORM2Research Areas: CardiovascularOrganism: Gorilla gorilla gorilla(Western lowland gorilla)AA Sequence:...

Recombinant Human Optineurin (OPTN) | CSB-EP016363HU | CusabioAlternative Name(s): E3-14.7K-interacting protein (FIP-2) (Huntingtin yeast partner L) (Huntingtin-interacting protein 7) (HIP-7) (Huntingtin-interacting protein L) (NEMO-related protein)...

Recombinant Human 5-oxoprolinase (OPLAH), partial | CSB-EP016350HU | CusabioAlternative Name(s): 5-oxo-L-prolinase;5-OPase;PyroglutamaseGene Names: OPLAHResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Opioid growth factor receptor (OGFR) | CSB-EP016311HU | CusabioAlternative Name(s): OGFr (Protein 7-60) (Zeta-type opioid receptor) Gene Names: OGFRResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ornithine decarboxylase (ODC1) | CSB-EP016269HU | CusabioAlternative Name(s): DCOR_HUMAN; Dodc1; Odc 1; ODC; Odc1; ODC2; Ornithine decarboxylase 1; Ornithine decarboxylase 2; Ornithine decarboxylase; Ornithine decarboxylase structural...

Recombinant Rat Oncomodulin (Ocm) | CSB-EP016264RA | CusabioAlternative Name(s): Parvalbumin betaGene Names: OcmResearch Areas: othersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Oncomodulin (Ocm) | CSB-EP016264MO | CusabioAlternative Name(s): Parvalbumin betaGene Names: OcmResearch Areas: NeuroscienceOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Nuclear pore glycoprotein p62 (Nup62) | CSB-EP016204RAb0 | CusabioAlternative Name(s): 62 kDa nucleoporin (Nucleoporin Nup62)Gene Names: Nup62Research Areas: Epigenetics and Nuclear SignalingOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl) | CSB-EP016086MO | CusabioAlternative Name(s): Nrl; Neural retina-specific leucine zipper protein; NRLGene Names: NrlResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Nuclear respiratory factor 1 (Nrf1) | CSB-EP016076MO | CusabioAlternative Name(s): Nuclear respiratory factor 1 Short name: NRF-1 Alternative name(s): Alpha palindromic-binding protein Short name: Alpha-palGene Names: Nrf1Research...

Recombinant Mouse Nuclear receptor subfamily 5 group A member 2 (Nr5a2) | CSB-EP016066MO | CusabioAlternative Name(s): Liver receptor homolog 1 (LRH-1) (Lrh1)Gene Names: Nr5a2Research Areas: Developmental BiologyOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1 | CusabioAlternative Name(s): Nuclear receptor subfamily 3 group C member 1 GRLGene Names: NR3C1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Nuclear receptor subfamily 2 group F member 6 (Nr2f6) | CSB-EP016058MO | CusabioAlternative Name(s): COUP transcription factor 3 (COUP-TF3) (V-erbA-related protein 2) (EAR-2) (Ear-2) (Ear2) (Erbal2)Gene Names: Nr2f6Research Areas:...

Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6) | CSB-EP016058HU | CusabioAlternative Name(s): V-erbA-related protein 2 Short name: EAR-2Gene Names: NR2F6Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r), partial | CSB-EP016036MO1 | CusabioAlternative Name(s): NPY-Y2 receptor (Y2 receptor)Gene Names: Npy2rResearch Areas: CardiovascularOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Atrial natriuretic peptide receptor 3 (Npr3), partial | CSB-EP016025RA1 | CusabioAlternative Name(s): Atrial natriuretic peptide clearance receptorAtrial natriuretic peptide receptor type C ;ANP-C ;ANPR-C ;NPR-CGene Names: Npr3Research...

Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial | CSB-EP016025HU1 | CusabioAlternative Name(s): Atrial natriuretic peptide clearance receptor (Atrial natriuretic peptide receptor type C) (ANP-C) (ANPR-C) (NPR-C) (ANPRC) (C5orf23)...

Recombinant Human Pro-FMRFamide-related neuropeptide FF (NPFF), partial | CSB-EP015981HU | CusabioAlternative Name(s): FMRFamide-related peptidesGene Names: NPFFResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence: SQAFLFQPQRFSource: E...

Recombinant Human Puromycin-sensitive aminopeptidase (NPEPPS), partial | CSB-EP015980HU | CusabioAlternative Name(s): Cytosol alanyl aminopeptidase (AAP-S) (PSA)Gene Names: NPEPPSResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neuropeptide B (NPB) | CSB-EP015971HUe1 | CusabioAlternative Name(s): Preproprotein L7 (hPPL7) (NPB23) (hL7) (hL7) (hL7C) (PPL7) (PPNPB)Gene Names: NPBResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neuropeptide B (NPB) | CSB-EP015971HU | CusabioAlternative Name(s): Preproprotein L7 (NPB23) (hL7) (NPB29) (hL7C)Gene Names: NPBResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence: WYKPAAGHSSYSVGRAAGLLSGLRRSPYASource: E...

Recombinant Rat NADPH oxidase 4 (Nox4), partial | CSB-EP015961RA | CusabioAlternative Name(s): Kidney oxidase-1Gene Names: Nox4Research Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1) | CSB-EP015889SVGb1 | CusabioAlternative Name(s): NDK1, YNKGene Names: YNK1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)AA...

Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1) | CSB-EP015889SVGa0 | CusabioAlternative Name(s): NDK (NDP kinase) (NDK1) (YNK)Gene Names: YNK1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)...

Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1) | CSB-EP015889SVG | CusabioAlternative Name(s): NDK1, YNKGene Names: YNK1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)AA...

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2) | CSB-EP015849MOe1 | CusabioAlternative Name(s): Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog BGene Names: Nkx3-2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2) | CSB-EP015849MOb2 | CusabioAlternative Name(s): Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog BGene Names: Nkx3-2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2) | CSB-EP015849MOb1 | CusabioAlternative Name(s): Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog BGene Names: Nkx3-2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Mouse Homeobox protein Nkx-2.2 (Nkx2-2) | CSB-EP015842MO | CusabioAlternative Name(s): Homeobox protein NK-2 homolog BGene Names: Nkx2-2 Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Homeobox protein Nkx-2.1 (NKX2-1) | CSB-EP015841HU | CusabioAlternative Name(s): Homeobox protein NK-2 homolog A (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) (Thyroid-specific enhancer-binding protein) (T/EBP)...

Recombinant Mouse Nidogen-1 (Nid1), partial | CSB-EP015802MO | CusabioAlternative Name(s): EntactinGene Names: Nid1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Nuclear transcription factor Y subunit beta (NFYB) | CSB-EP015774HU | CusabioAlternative Name(s): CAAT box DNA-binding protein subunit B Nuclear transcription factor Y subunit BGene Names: NFYBResearch Areas: Signal Transduction...

Recombinant Mouse Merlin (Nf2), partial | CSB-EP015741MO1 | CusabioAlternative Name(s): Moesin-ezrin-radixin-like protein (Neurofibromin-2) (Schwannomin) (Nf-2)Gene Names: Nf2Research Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Merlin (NF2) | CSB-EP015741HU | CusabioAlternative Name(s): Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomerlin Schwannomin SCHGene Names: NF2Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Sialidase-1 (Neu1) | CSB-EP015717MO | CusabioAlternative Name(s): G9 sialidase (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1) (Neu)Gene Names: Neu1Research Areas: MicrobiologyOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human Neurofilament medium polypeptide (NEFM), partial | CSB-EP015691HU | CusabioAlternative Name(s): 160 kDa neurofilament protein (Neurofilament 3) (Neurofilament triplet) (M protein) (NEF3) (NFM)Gene Names: NEFMResearch Areas:...

Recombinant Rat Neurofilament light polypeptide (Nefl) | CSB-EP015688RA | CusabioAlternative Name(s): 68 kDa neurofilament protein (Neurofilament triplet L protein) (Nf68) (Nfl) (NF-L)Gene Names: NeflResearch Areas: NeuroscienceOrganism: Rattus...

Recombinant Staphylococcus aureus Acyl carrier protein (acpP) | CSB-EP015636SKX | CusabioAlternative Name(s): hmrBGene Names: acpPResearch Areas: OthersOrganism: Staphylococcus aureus (strain Mu50 / ATCC 700699)AA Sequence:...

Recombinant Escherichia coli Acyl carrier protein (acpP) | CSB-EP015636ENV | CusabioAlternative Name(s): Cytosolic-activating factorGene Names: acpPResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Human Norrin (Ndp) | CSB-EP015609HU | CusabioAlternative Name(s): Norrin(Norrie disease protein)(X-linked exudative vitreoretinopathy 2 protein)Gene Names: NdpResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Neural cell adhesion molecule 1 (Ncam1), partial | CSB-EP015511RA | CusabioAlternative Name(s): CD_antigen: CD56Gene Names: Ncam1Research Areas: NeuroscienceOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Neuron navigator 3 (Nav3), partial | CSB-EP015480MO | CusabioAlternative Name(s): Neuron navigator 3(Pore membrane and/or filament-interacting-like protein 1)Gene Names: Nav3Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Human Neuron navigator 1 (NAV1), partial | CSB-EP015478HU2 | CusabioAlternative Name(s): Pore membrane and/or filament-interacting-like protein 3 Steerin-1 Unc-53 homolog 1Gene Names: NAV1Research Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Neuron navigator 1 (NAV1), partial | CSB-EP015478HU1 | CusabioAlternative Name(s): Pore membrane and/or filament-interacting-like protein 3 Steerin-1 Unc-53 homolog 1Gene Names: NAV1Research Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Arylamine N-acetyltransferase 2 (NAT2) | CSB-EP015471HU | CusabioAlternative Name(s): Arylamide acetylase 2 N-acetyltransferase type 2 Short name: NAT-2 Polymorphic arylamine N-acetyltransferase Short name: PNATGene Names: NAT2Research...

Recombinant Mouse Myocilin (Myoc), partial | CSB-EP015356MO | CusabioAlternative Name(s): Trabecular meshwork-induced glucocorticoid response proteinGene Names: MyocResearch Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus (Mouse)AA...

Recombinant Human Myosin light chain 3 (MYL3) | CSB-EP015310HU | CusabioAlternative Name(s): Cardiac myosin light chain 1Gene Names: MYL3Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Myc proto-oncogene protein (Myc) | CSB-EP015270MO | CusabioAlternative Name(s): Proto-oncogene c-MycTranscription factor p64Gene Names: MycResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Methylmalonyl-CoA mutase, mitochondrial (Mutc) | CSB-EP015243MO | CusabioAlternative Name(s): Methylmalonyl-CoA isomeraseGene Names: MutResearch Areas: MetabolismOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Metaxin-2 (MTX2) | CSB-EP015213HU | CusabioAlternative Name(s): Mitochondrial outer membrane import complex protein 2Gene Names: MTX2Research Areas: Tags & Cell MarkersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Metallothionein-4 (MT4) | CSB-EP015123HU | CusabioAlternative Name(s): Metallothionein-IVGene Names: MT4Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Metallothionein-3 (Mt3) | CSB-EP015122MO | CusabioAlternative Name(s): Growth inhibitory factor Short name: GIFGene Names: Mt3Research Areas: NeuroscienceOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial | CSB-EP015072HU | CusabioAlternative Name(s): Cytochrome c oxidase polypeptide I (COI) (COXI) (MTCO1)Gene Names: MT-CO1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Mesothelin (Msln), partial | CSB-EP015044MO | CusabioAlternative Name(s): Pre-pro-megakaryocyte-potentiating factorGene Names: MslnResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) , partial | CSB-EP015007MO2 | CusabioAlternative Name(s): B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20Gene Names: Ms4a1Research Areas:...

Recombinant Human 28S ribosomal protein S6, mitochondrial (MRPS6) | CSB-EP014937HU | CusabioAlternative Name(s): MRPS6; C21orf101; RPMS628S ribosomal protein S6; mitochondrial; MRP-S6; S6mt; Mitochondrial small ribosomal subunit protein bS6mGene Names:...