N-terminal 6xHis-SUMO-tagged Recombinant

Recombinant Escherichia coli Tetracycline repressor protein class B from transposon Tn10 (tetR) | CSB-EP366163ENL | CusabioAlternative Name(s): tetR; Tetracycline repressor protein class B from transposon Tn10Gene Names: tetRResearch Areas:...

Recombinant Escherichia coli Modification methylase EcoRV (ecoRVM) | CSB-EP366147ENL | CusabioAlternative Name(s): Adenine-specific methyltransferase EcoRVGene Names: ecoRVMResearch Areas: OthersOrganism: Escherichia coliAA Sequence:...

Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5?2.5? | CSB-EP366021EEB | CusabioAlternative Name(s): Single-stranded DNA-binding protein ;SSB proteinGene Names: 2.5Research Areas: OthersOrganism: Enterobacteria phage T3...

Recombinant Rabies virus Glycoprotein (G), partial | CSB-EP365970RID | CusabioAlternative Name(s): GGlycoproteinGene Names: GResearch Areas: OthersOrganism: Rabies virus (strain ERA) (RABV)AA Sequence:...

Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial | CSB-EP365937HPO | CusabioAlternative Name(s): Attachment glycoprotein GMembrane-bound glycoprotein ;mGGene Names: GResearch Areas: OthersOrganism: Human...

Recombinant Epstein-Barr virus Envelope glycoprotein H (gH), partial | CSB-EP365883EFA | CusabioAlternative Name(s): Glycoprotein 85 Short name:gp85Gene Names: gHResearch Areas: OthersOrganism: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus...

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 1 (EBNA1), partial | CSB-EP365878EFA | CusabioAlternative Name(s): EBNA1; BKRF1; Epstein-Barr nuclear antigen 1; EBNA-1; EBV nuclear antigen 1Gene Names: EBNA1Research Areas:...

Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2) | CSB-EP365848HML | CusabioAlternative Name(s): L2; Minor capsid protein L2Gene Names: L2Research Areas: OthersOrganism: Human papillomavirus type 16AA Sequence:...

Recombinant Escherichia coli Lactose operon repressor (lacI) | CSB-EP365825ENV | CusabioAlternative Name(s): lacI; b0345; JW0336; Lactose operon repressorGene Names: lacIResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Penicillin-binding protein 1A (mrcA), partial | CSB-EP365805ENV | CusabioAlternative Name(s): Short name: PBP-1a Short name: PBP1a Including the following 2 domains: Penicillin-insensitive transglycosylase Alternative...

Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial | CSB-EP365684MO | CusabioAlternative Name(s): H2-D1; H-2 class I histocompatibility antigen; D-D alpha chain; H-2D(D)Gene Names: H2-D1Research Areas:...

Recombinant Human Interferon alpha-1/13 (IFNA1) | CSB-EP365592HU | CusabioAlternative Name(s): Interferon alpha-D ;LeIF DGene Names: IFNA1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Staphylococcus aureus Enterotoxin type C-1 (entC1) | CSB-EP365590FKZ | CusabioAlternative Name(s): SEC1Gene Names: entC1Research Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Viscum album Viscotoxin-A3 (THI2.1), partial | CSB-EP365586VDO | CusabioAlternative Name(s): THI2.1; Viscotoxin-A3 [Cleaved into: Viscotoxin-A3; Acidic protein]Gene Names: THI2.1Research Areas: AllergenOrganism: Viscum album (European...

Recombinant Mouse Complement C3 (C3), partial | CSB-EP365507MO | CusabioAlternative Name(s): HSE-MSFGene Names: C3Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Escherichia coli Hygromycin-B 4-O-kinase (hph) | CSB-EP365448ENL | CusabioAlternative Name(s): APH(4)Hygromycin B phosphotransferaseHygromycin-B kinaseGene Names: hphResearch Areas: OthersOrganism: Escherichia coliAA Sequence:...

Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial | CSB-EP365424FKI | CusabioAlternative Name(s): PETE; Plastocyanin; chloroplasticGene Names: PETEResearch Areas: OthersOrganism: Spinacia oleracea (Spinach)AA Sequence:...

Recombinant Escherichia coli Exopolyphosphatase (ppx) | CSB-EP365319ENV | CusabioAlternative Name(s): MetaphosphataseGene Names: ppxResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Glc operon transcriptional activator (glcC) | CSB-EP364823EGX | CusabioAlternative Name(s): glcC; c3710; Glc operon transcriptional activator; Glc regulatory protein; HTH-type transcriptional regulator GlcCGene Names:...

Recombinant Shigella flexneri Glutaredoxin-4 (grxD) | CSB-EP364758SZB | CusabioAlternative Name(s): Monothiol glutaredoxin (ydhD) (Grx4)Gene Names: grxDResearch Areas: Cell BiologyOrganism: Shigella flexneriAA Sequence:...

Recombinant Escherichia coli Crossover junction endodeoxyribonuclease RuvC (ruvC) | CSB-EP364095ENV | CusabioAlternative Name(s): Holliday junction nuclease RuvCHolliday junction resolvase RuvCGene Names: ruvCResearch Areas: OthersOrganism: Escherichia...

Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvB (ruvB) | CSB-EP364094ENV | CusabioAlternative Name(s): ruvB; b1860; JW1849; Holliday junction ATP-dependent DNA helicase RuvB; EC 3.6.4.12Gene Names: ruvBResearch Areas:...

Recombinant Escherichia coli DNA repair protein recO (recO) | CSB-EP364006ENV | CusabioAlternative Name(s): Recombination protein OGene Names: recOResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli LexA repressor (lexA) | CSB-EP363985ENV | CusabioAlternative Name(s): lexA; exrA; spr; tsl; umuA; b4043; JW4003LexA repressor; EC 3.4.21.88Gene Names: lexAResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA...

Recombinant Escherichia coli Glutamate--cysteine ligase (gshA) | CSB-EP363915ENV | CusabioAlternative Name(s): Gamma-ECS ;GCSGamma-glutamylcysteine synthetaseGene Names: gshAResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Cytidylate kinase (cmk) | CSB-EP363865ENV | CusabioAlternative Name(s): Cytidine monophosphate kinase ;CMP kinaseProtein MssAp25Gene Names: cmkResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Mycobacterium tuberculosis Enoyl-[acyl-carrier-protein] reductase [NADH] (inhA) | CSB-EP363781MVZ | CusabioAlternative Name(s): NADH-dependent enoyl-ACP reductaseGene Names: inhAResearch Areas: Signal TransductionOrganism: Mycobacterium...

Recombinant Mycobacterium tuberculosis ESAT-6-like protein EsxH (esxH), partial | CSB-EP363659MVZ | CusabioAlternative Name(s): 10KDA antigen CFP7 ;CFP-7Low molecular weight protein antigen 7Protein TB10.4Gene Names: esxHResearch Areas: OthersOrganism:...

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) | CSB-EP363615MVZ | CusabioAlternative Name(s): mpt51; fbpC1; fbpD; mpb51; MT3910; MPT51/MPB51 antigenGene Names: mpt51Research Areas: OthersOrganism: Mycobacterium tuberculosis (strain...

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial | CSB-EP363358BDC | CusabioAlternative Name(s): 130KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)Gene Names:...

Recombinant Neisseria meningitidis serogroup B Penicillin-binding protein 1A (mrcA), partial | CSB-EP363014NGG | CusabioAlternative Name(s): Peptidoglycan TGase DD-transpeptidaseGene Names: mrcAResearch Areas: OthersOrganism: Neisseria meningitidis...

Recombinant Staphylococcus aureus Enterotoxin type G (entG) | CSB-EP362954SKX | CusabioAlternative Name(s): SEGGene Names: entGResearch Areas: OthersOrganism: Staphylococcus aureus (strain Mu50 / ATCC 700699)AA Sequence:...

Recombinant Erythrina caffra Trypsin inhibitor DE-3 | CSB-EP362840EGO | CusabioAlternative Name(s): Trypsin inhibitor DE-3Gene Names: N/AResearch Areas: OthersOrganism: Erythrina caffra (Kaffir tree) (Coastal coral tree)AA Sequence:...

Recombinant Dog Arginine esterase | CSB-EP362734DO | CusabioAlternative Name(s): Arginine esterase; EC 3.4.21.35Gene Names: N/AResearch Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Bacillus subtilis Phosphocarrier protein HPr (ptsH) | CSB-EP362538BRJ | CusabioAlternative Name(s): Histidine-containing proteinGene Names: ptsHResearch Areas: OthersOrganism: Bacillus subtilis (strain 168)AA Sequence:...

Recombinant Human herpesvirus 2 Envelope glycoprotein B (gB), partial | CSB-EP362479HJX | CusabioAlternative Name(s): gB; UL27; Envelope glycoprotein B; gBGene Names: gBResearch Areas: OthersOrganism: Human herpesvirus 2 (strain HG52) (HHV-2) (Human...

Recombinant Human U2 small nuclear ribonucleoprotein B (SNRPB2) | CSB-EP362460HU | CusabioAlternative Name(s): 2810052G09Rik; MGC24807; MGC45309; Msl1; OTTHUMP00000030324; OTTHUMP00000030325; OTTMUSP00000016621; OTTMUSP00000016622; RP23-371L4.1;...

Recombinant Human rhinovirus A serotype 89 Genome polyprotein, partial | CSB-EP362073HQD | CusabioAlternative Name(s): Genome polyprotein [Cleaved into: P1; Capsid protein VP0; VP4-VP2); Capsid protein VP4; P1A; Virion protein 4); Capsid protein VP2;...

Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1 (tst) | CSB-EP361973FKZ | CusabioAlternative Name(s): TSST-1Gene Names: tstResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Dog Cationic trypsin | CSB-EP361971DO | CusabioAlternative Name(s): ; Cationic trypsin; EC 3.4.21.4Gene Names: N/AResearch Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Saccharomyces cerevisiae DNA repair and recombination protein RAD52 (RAD52), partial | CSB-EP361943SVG | CusabioAlternative Name(s): RAD52; YML032C; DNA repair and recombination protein RAD52Gene Names: RAD52Research Areas: OthersOrganism:...

Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG), partial | CSB-EP361844HWY1 | CusabioAlternative Name(s): gG-1Gene Names: gG US4 Research Areas: OthersOrganism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)AA...

Recombinant Pseudomonas aeruginosa Porin P (oprP) | CSB-EP361596EZX | CusabioAlternative Name(s): Outer membrane protein D1Gene Names: oprPResearch Areas: MetabolismOrganism: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)AA...

Recombinant Zea mays (Maize) Sucrose synthase 1 (SH-1), partial | CSB-EP361346ZAX | CusabioAlternative Name(s): Shrunken-1 Sucrose-UDP glucosyltransferase 1Gene Names: SH-1Research Areas: OthersOrganism: Zea mays (Maize)AA Sequence:...

Recombinant Influenza B virus Nucleoprotein (NP) | CSB-EP361330IJK | CusabioAlternative Name(s): Nucleocapsid protein ;Protein NGene Names: NPResearch Areas: OthersOrganism: Influenza B virus (strain B/Lee/1940)AA Sequence:...

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial | CSB-EP361302HKP | CusabioAlternative Name(s): Env polyproteinGene Names: envResearch Areas: OthersOrganism: Human immunodeficiency virus type 1...

Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX) | CSB-EP361289EDZ | CusabioAlternative Name(s): UVSX,Recombination and repair proteinGene Names: UVSXResearch Areas: OthersOrganism: Enterobacteria phage T4 (Bacteriophage T4)AA...

Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA) | CSB-EP361210ENV | CusabioAlternative Name(s): Type-1A pilinGene Names: fimAResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Human T-cell leukemia virus 1 Envelope glycoprotein gp62 (env), partial | CSB-EP361037HQJa2 | CusabioAlternative Name(s): Env polyproteinGene Names: envResearch Areas: MetabolismOrganism: Human T-cell leukemia virus 1 (strain Japan ATK-1...

Recombinant Epstein-Barr virus Envelope glycoprotein GP350 (BLLF1), partial | CSB-EP360986EFA | CusabioAlternative Name(s): Membrane antigen Short name: MAGene Names: BLLF1Research Areas: OthersOrganism: Epstein-Barr virus (strain B95-8) (HHV-4) (Human...

Recombinant BK polyomavirus Minor capsid protein VP2 | CSB-EP360956BGY | CusabioAlternative Name(s): Minor capsid protein VP2; Minor structural protein VP2Gene Names: N/AResearch Areas: OthersOrganism: BK polyomavirus (BKPyV) (Human polyomavirus 1)AA...

Recombinant Staphylococcus aureus Replication initiation protein (repD) | CSB-EP360946FKZ | CusabioAlternative Name(s): repD; Replication initiation proteinGene Names: repDResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Mouse Major urinary protein 6 (Mup6) | CSB-EP360881MO | CusabioAlternative Name(s): Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1Gene Names: Mup6Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Glycine max Bowman-Birk type proteinase inhibitor D-II | CSB-EP360616GGV | CusabioAlternative Name(s): IVGene Names: N/AResearch Areas: OthersOrganism: Glycine max (Soybean) (Glycine hispida)AA Sequence:...

Recombinant Anas platyrhynchos Lysozyme C-1 | CSB-EP360572BZD | CusabioAlternative Name(s): 1,4-beta-N-acetylmuramidase CGene Names: N/AResearch Areas: OthersOrganism: Anas platyrhynchos (Mallard) (Anas boschas)AA Sequence:...

Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1) | CSB-EP360492SVG | CusabioAlternative Name(s): Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1Gene Names: YPT1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC...

Recombinant Escherichia coli Beta-lactamase (ampC) | CSB-EP360448ENV | CusabioAlternative Name(s): Cephalosporinase (ampA)Gene Names: ampCResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Signal peptidase I (lepB), partial | CSB-EP360447ENV | CusabioAlternative Name(s): Leader peptidase IGene Names: lepBResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Enterobacteria phage T4 Endolysin (E) | CSB-EP360435EDZ | CusabioAlternative Name(s): Lysis protein Lysozyme MuramidaseGene Names: EResearch Areas: MicrobiologyOrganism: Enterobacteria phage T4 (Bacteriophage T4)AA Sequence:...

Recombinant Clostridium pasteurianum Rubredoxin | CSB-EP360387CMA | CusabioAlternative Name(s): Short name:RdGene Names: N/AResearch Areas: OthersOrganism: Clostridium pasteurianumAA Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEESource:...

Recombinant Escherichia coli Peptidyl-prolyl cis-trans isomerase A (ppiA) | CSB-EP360284EOD | CusabioAlternative Name(s): PPIase A Alternative name(s): Cyclophilin A Rotamase AGene Names: ppiAResearch Areas: ImmunologyOrganism: Escherichia coli O157:H7AA...

Recombinant Escherichia coli Methionine aminopeptidase (map) | CSB-EP360042ENV | CusabioAlternative Name(s): Peptidase MGene Names: mapResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC (lptC) | CSB-EP360015EGXa2 | CusabioAlternative Name(s): lptC; c3959; Lipopolysaccharide export system protein LptCGene Names: lptCResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA) | CSB-EP360010ENV | CusabioAlternative Name(s): lptA; yhbN; b3200; JW3167; Lipopolysaccharide export system protein LptAGene Names: lptAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Murein hydrolase activator NlpD (nlpD) | CSB-EP359913ENV | CusabioAlternative Name(s): nlpD; b2742; JW2712Murein hydrolase activator NlpDGene Names: nlpDResearch Areas: MicrobiologyOrganism: Escherichia coli (strain K12)AA...

Recombinant Escherichia coli O157:H7 DNA-binding protein HU-alpha (hupA) | CSB-EP359761EOD | CusabioAlternative Name(s): HU-2 NS2Gene Names: hupAResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Escherichia coli Chaperone surA (surA) | CSB-EP359693ENV | CusabioAlternative Name(s): Peptidyl-prolyl cis-trans isomerase SurA (EC:5.2.1.8) ;PPIase SurARotamase SurASurvival protein AGene Names: surAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Lipopolysaccharide assembly protein B (lapB), partial | CSB-EP359577ENV | CusabioAlternative Name(s): lapB; yciM; b1280; JW1272; Lipopolysaccharide assembly protein B; Lipopolysaccharide regulatory proteinGene Names:...

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) | CSB-EP359466ENV | CusabioAlternative Name(s): 3-oxoacyl-[acyl-carrier-protein] synthase IIBeta-ketoacyl-ACP synthase II ;KAS IIGene Names: fabFResearch Areas:...

Recombinant Escherichia coli O6:H1 Cell division protein FtsZ (ftsZ) | CSB-EP359270EGX | CusabioAlternative Name(s): ftsZ; c0113Cell division protein FtsZGene Names: ftsZResearch Areas: OthersOrganism: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928...

Recombinant Escherichia coli Glutamate-pyruvate aminotransferase AlaA (alaA) | CSB-EP359250ENV | CusabioAlternative Name(s): alaA; yfbQ; b2290; JW2287Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2Gene Names: alaAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli 3-oxoacyl-[acyl-carrier-protein] synthase 1 (fabB) | CSB-EP359247ENV | CusabioAlternative Name(s): 3-oxoacyl-[acyl-carrier-protein] synthase I Beta-ketoacyl-ACP synthase IGene Names: fabBResearch Areas: OthersOrganism:...

Recombinant Escherichia coli O157:H7 Outer membrane protein A (ompA), partial | CSB-EP359226EOD | CusabioAlternative Name(s): Outer membrane protein II*Gene Names: ompAResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvA (ruvA) | CSB-EP359062ENV | CusabioAlternative Name(s): ruvA; b1861; JW1850; Holliday junction ATP-dependent DNA helicase RuvA; EC 3.6.4.12Gene Names: ruvAResearch Areas:...

Recombinant Escherichia coli Recombination protein RecR (recR) | CSB-EP358976ENV | CusabioAlternative Name(s): recR; b0472; JW0461; Recombination protein RecRGene Names: recRResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli DNA replication and repair protein RecF (recF) | CSB-EP358973ENV | CusabioAlternative Name(s): recF; uvrF; b3700; JW3677; DNA replication and repair protein RecFGene Names: recFResearch Areas: OthersOrganism: Escherichia coli...

Recombinant Escherichia coli UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) | CSB-EP358910ENVa2 | CusabioAlternative Name(s): Protein EnvA UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylaseGene Names: lpxCResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Elongation factor P (efp) | CSB-EP358853ENV | CusabioAlternative Name(s): Short name:EF-PGene Names: efpResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85A (fbpA) | CSB-EP358584MVZ | CusabioAlternative Name(s): DGAT(Acyl-CoA:diacylglycerol acyltransferase) (Antigen 85 complex A) (85A) (Ag85A) (Fibronectin-binding...

Recombinant Staphylococcus aureus Enterotoxin type H (entH) | CSB-EP357926FKZ | CusabioAlternative Name(s): SEHGene Names: entHResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Staphylococcus aureus Enterotoxin type G (entG) | CSB-EP357924SKY | CusabioAlternative Name(s): SEGGene Names: entGResearch Areas: OthersOrganism: Staphylococcus aureus (strain N315)AA Sequence:...

Recombinant Staphylococcus aureus Enterotoxin type C-3 (entC3) | CSB-EP357923FKZ | CusabioAlternative Name(s): SEC3Gene Names: entC3Research Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB) | CSB-EP357862SKYa2 | CusabioAlternative Name(s): H-gamma-1 H-gamma-IGene Names: hlgBResearch Areas: MicrobiologyOrganism: Staphylococcus aureus (strain N315)AA Sequence:...

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial | CSB-EP357830LKW | CusabioAlternative Name(s): Stable signal peptide Short name: SSP Glycoprotein G1 Short name: GP1 Glycoprotein G2 Short...

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin | CSB-EP357829TIF | CusabioAlternative Name(s): Ribosome-inactivating protein alpha-trichosanthin; Alpha-TCS; EC 3.2.2.22; rRNA N-glycosidaseGene Names: N/AResearch...

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) | CSB-EP357663ECC | CusabioAlternative Name(s): Verocytotoxin 2 subunit B ;Verotoxin 2 subunit BGene Names: stxB2Research Areas: OthersOrganism: Enterobacteria phage 933W...

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3), partial | CSB-EP357412MO | CusabioAlternative Name(s): Fc-gamma RIII Short name: FcRIII CD_antigen: CD16Gene Names: Fcgr3Research Areas: OthersOrganism: Mus musculus...

Recombinant Escherichia coli 8-oxo-dGTP diphosphatase (mutT) | CSB-EP357355ENV | CusabioAlternative Name(s): 7,8-dihydro-8-oxoguanine-triphosphatase Mutator protein MutT dGTP pyrophosphohydrolaseGene Names: mutTResearch Areas: OthersOrganism: Escherichia...

Recombinant Dermatophagoides pteronyssinus Peptidase 1 (DERP1) | CSB-EP357315DJH | CusabioAlternative Name(s): Allergen Der p I Major mite fecal allergen Der p 1 Allergen: Der p 1Gene Names: DERP1Research Areas: OthersOrganism: Dermatophagoides...

Recombinant Acinetobacter baylyi Catechol 1, 2-dioxygenase (catA) | CSB-EP357202AWW | CusabioAlternative Name(s): 1,2-CTDGene Names: catAResearch Areas: MicrobiologyOrganism: Acinetobacter baylyi AA Sequence:...

Recombinant Human parvovirus B19 Non-capsid protein NS-1 (NS1), partial | CSB-EP357083HPM | CusabioAlternative Name(s): NCVP1 Non-structural protein NS1Gene Names: NS1Research Areas: MicrobiologyOrganism: Human parvovirus B19 (isolate AU) (HPV B19)AA...

Recombinant Escherichia coli Methyl-accepting chemotaxis protein II (tar), partial | CSB-EP356999ENV | CusabioAlternative Name(s): Aspartate chemoreceptor proteinGene Names: tarResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Escherichia coli Outer membrane protein C (ompC) | CSB-EP356994ENV | CusabioAlternative Name(s): Outer membrane protein 1BPorin OmpCGene Names: ompCResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Human immunodeficiency virus type 2 subtype A Protein Vpx (vpx) | CSB-EP356976HLZ | CusabioAlternative Name(s): Viral protein X X ORF proteinGene Names: vpxResearch Areas: OthersOrganism: Human immunodeficiency virus type 2 subtype A (isolate...

Recombinant Dog Anionic trypsin | CSB-EP356954DO | CusabioAlternative Name(s): ; Anionic trypsin; EC 3.4.21.4Gene Names: N/AResearch Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2) | CSB-EP356939HMN | CusabioAlternative Name(s): L2; Minor capsid protein L2Gene Names: L2Research Areas: OthersOrganism: Human papillomavirus type 18AA Sequence:...

Recombinant Escherichia coli Heat-labile enterotoxin A chain (eltA) | CSB-EP356922ENLa3 | CusabioAlternative Name(s): LT-A, porcine LTP-AGene Names: eltAResearch Areas: OthersOrganism: Escherichia coliAA Sequence:...

Recombinant Chlamydia trachomatis serovar L2 Major outer membrane porin (ompA) | CSB-EP356881DSG | CusabioAlternative Name(s): MOMPGene Names: ompAResearch Areas: MicrobiologyOrganism: Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)AA...

Recombinant Saccharomyces cerevisiae Alpha-galactosidase 1 (MEL1) | CSB-EP356371SAC | CusabioAlternative Name(s): Alpha-D-galactoside galactohydrolase 1Melibiase 1Gene Names: MEL1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC...

Recombinant Influenza B virus Nucleoprotein (NP) | CSB-EP356318IJU(A4) | CusabioAlternative Name(s): Nucleocapsid protein ;Protein NGene Names: NPResearch Areas: OthersOrganism: Influenza B virus (strain B/Singapore/222/1979)AA Sequence:...