Cusabio Canis lupus familiaris Recombinants
Recombinant Dog Cationic trypsin | CSB-EP361971DO
- SKU:
- CSB-EP361971DO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Dog Cationic trypsin | CSB-EP361971DO | Cusabio
Alternative Name(s): ; Cationic trypsin; EC 3.4.21.4
Gene Names: N/A
Research Areas: Others
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
AA Sequence: IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 24-246aa
Sequence Info: Full Length of Mature Protein
MW: 39.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.
Reference: "Differential regulation of trypsinogen mRNA translation: full-length mRNA sequences encoding two oppositely charged trypsinogen isoenzymes in the dog pancreas." Pinsky S.D., Laforge K.S., Scheele G. Mol. Cell. Biol. 5:2669-2676(1985)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted, extracellular space
Protein Families: Peptidase S1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P06871
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: STRING
OMIM Database Link: N/A