Others Recombinants

Recombinant Mouse Hydroxymethylglutaryl-CoA synthase, Cytoplasmic (Hmgcs1) | CSB-EP812948MO | CusabioAlternative Name(s): 3-hydroxy-3-methylglutaryl coenzyme A synthaseGene Names: Hmgcs1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Abhydrolase domain-containing protein 11 (Abhd11) | CSB-EP811717MO | CusabioAlternative Name(s): Williams-Beuren syndrome chromosomal region 21 protein homologGene Names: Abhd11Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Escherichia coli O6:H1 Replicative DNA helicase (dnaB) | CSB-EP811243EGXa0 | CusabioAlternative Name(s): dnaB; c5026Replicative DNA helicase; EC 3.6.4.12Gene Names: dnaBResearch Areas: OthersOrganism: Escherichia coli O6:H1 (strain CFT073 /...

Recombinant Chikungunya virus Non-structural protein 4 (nsP4), partial | CSB-EP810351CJAT | CusabioAlternative Name(s): Polyprotein nsP1234Gene Names: nsp4Research Areas: OthersOrganism: Chikungunya virus (strain S27-African prototype) (CHIKV)AA...

Recombinant Reston ebolavirus Matrix protein VP40 (VP40) | CSB-EP810348RCJ | CusabioAlternative Name(s): Membrane-associated protein VP40Gene Names: VP40Research Areas: OthersOrganism: Reston ebolavirus (strain Reston-89) (REBOV) (Reston Ebola virus)AA...

Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN) | CSB-EP810224MOV | CusabioAlternative Name(s): FXN; FRDA1; QnpA-13971; Frataxin; mitochondrial; Fxn; EC 1.16.3.1) [Cleaved into: Frataxin intermediate form; Frataxin mature form]Gene Names:...

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial | CSB-EP807451MO1 | CusabioAlternative Name(s): Dock8Dedicator of cytokinesis protein 8Gene Names: Dock8Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial | CSB-EP807451MO | CusabioAlternative Name(s): Dock8Dedicator of cytokinesis protein 8Gene Names: Dock8Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Negative regulator of reactive oxygen species (Nrros), partial | CSB-EP807383MO | CusabioAlternative Name(s): Leucine-rich repeat-containing protein 33 (Negative regulator of reactive oxygen species) (Lrrc33)Gene Names: NrrosResearch...

Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130) , partial | CSB-EP807359MO | CusabioAlternative Name(s): 130KDA Sin3-associated polypeptide Sin3-associated polypeptide p130Gene Names: Sap130Research Areas: OthersOrganism: Mus...

Recombinant Mouse RNA binding protein fox-1 homolog 3 (Rbfox3) | CSB-EP806847MO | CusabioAlternative Name(s): Fox-1 homolog C (Hexaribonucleotide-binding protein 3) (Fox-3) (Neuronal nuclei antigen) (NeuN antigen) (D11Bwg0517e) (Hrnbp3)Gene Names:...

Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L), partial | CSB-EP806333VBE | CusabioAlternative Name(s): Large structural protein Replicase TranscriptaseGene Names: LResearch Areas: OthersOrganism: Vesicular stomatitis...

Recombinant Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog (Wdpcp) | CSB-EP804911MO | CusabioAlternative Name(s): Homolog-13WD repeat-containing and planar cell polarity effector proteinGene Names: WdpcpResearch Areas:...

Recombinant Mouse Sialidase-4 (Neu4) | CSB-EP803970MO | CusabioAlternative Name(s): N-acetyl-alpha-neuraminidase 4 (Neuraminidase 4)Gene Names: Neu4Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Thioredoxin-interacting protein (Txnip) | CSB-EP803849MO | CusabioAlternative Name(s): Vitamin D3 up-regulated protein 1Gene Names: TxnipResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Pseudomonas syringae pv. tomato Effector protein hopM1 (hopM1) | CSB-EP803414FGP(A4) | CusabioAlternative Name(s): Hrp outer protein M1 (Type III effector HopPtoM) (holPtoX) (hopPtoM)Gene Names: hopM1Research Areas: OthersOrganism:...

Recombinant Klebsiella oxytoca Carbepenem-hydrolyzing beta-lactamase KPC (bla) | CSB-EP802889KBE | CusabioAlternative Name(s): Carbapenem-hydrolyzing beta-lactamase KPC-2Gene Names: blaResearch Areas: OthersOrganism: Klebsiella oxytocaAA Sequence:...

Recombinant Human Transforming growth factor beta activator LRRC33 (NRROS), partial | CSB-EP801264HU | CusabioAlternative Name(s): Leucine-rich repeat-containing protein 33 LRRC33Gene Names: NRROSResearch Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Interferon epsilon (Ifne) | CSB-EP800374MO | CusabioAlternative Name(s): Interferon epsilon-1Interferon tau-1Gene Names: IfneResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Septin-9 (Septin9) | CSB-EP800330MO | CusabioAlternative Name(s): SL3-3 integration site 1 protein Kiaa0991, Sint1Gene Names: Septin9Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Filamin-A-interacting protein 1 (FILIP1), partial | CSB-EP800226HU | CusabioAlternative Name(s): Filamin-A-interacting protein 1; FILIP; FILIP1; FLIP1_HUMANGene Names: FILIP1Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Artemisia vulgaris Major pollen allergen Art v 1 | CSB-EP774628AOH | CusabioAlternative Name(s): Defensin-like protein 1 Allergen: Art v 1Gene Names: N/AResearch Areas: OthersOrganism: Artemisia vulgaris (Mugwort)AA Sequence:...

Recombinant Androctonus mauretanicus mauretanicus Alpha-toxin Amm8 | CSB-EP773772AKB | CusabioAlternative Name(s): Alpha-anatoxin Amm VIII (Amm VIII) (AmmVIII) (Neurotoxin 8) (P4)Gene Names: N/AResearch Areas: OthersOrganism: Androctonus mauritanicus...

Recombinant Human papillomavirus type 6a protein E4 (E4) | CSB-EP772797HOM | CusabioAlternative Name(s): /Gene Names: E4Research Areas: OthersOrganism: Human papillomavirus type 6aAA Sequence:...

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQVa2 | CusabioAlternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3Gene Names: LTBResearch Areas: OthersOrganism: Pan troglodytes...

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQV | CusabioAlternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3Gene Names: LTBResearch Areas: OthersOrganism: Pan troglodytes...

Recombinant Bacillus anthracis Single-stranded DNA-binding protein (ssb) | CSB-EP770616BQE | CusabioAlternative Name(s): ssb; ssb-1; BA_5722; GBAA_5722; BAS5326Single-stranded DNA-binding protein; SSBGene Names: ssbResearch Areas: OthersOrganism:...

Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1) | CSB-EP770515MO | CusabioAlternative Name(s): Nmes1Normal mucosa of esophagus-specific gene 1 proteinGene Names: Nmes1Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Carnosine N-methyltransferase (Carnmt1), partial | CSB-EP770467MO1a2 | CusabioAlternative Name(s): Gene Names: Carnmt1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Enterococcus faecalis Gelatinase (gelE) | CSB-EP769310ELW | CusabioAlternative Name(s): CoccolysinGene Names: gelEResearch Areas: OthersOrganism: Enterococcus faecalis (strain ATCC 700802 / V583)AA Sequence:...

Recombinant Vesicular stomatitis Indiana virus Protein C' (P) | CSB-EP768100VBH | CusabioAlternative Name(s): PProtein C'Gene Names: pResearch Areas: OthersOrganism: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)AA Sequence:...

Recombinant Portulaca grandiflora 4, 5-DOPA dioxygenase extradiol (DODA) | CSB-EP767105PIAD | CusabioAlternative Name(s): DODA4,5-DOPA dioxygenase extradiol; EC 1.13.11.29Gene Names: DODAResearch Areas: OthersOrganism: Portulaca grandiflora (Rose moss)AA...

Recombinant Salmo salar Elastase-1 | CSB-EP766453SWI | CusabioAlternative Name(s): Gene Names: N/AResearch Areas: OthersOrganism: Salmo salar (Atlantic salmon)AA Sequence:...

Recombinant Zaire ebolavirus Polymerase cofactor VP35 (VP35) | CSB-EP764950ZAT | CusabioAlternative Name(s): Ebola VP35; eVP35Gene Names: VP35Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA Sequence:...

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial | CSB-EP764949ZAT | CusabioAlternative Name(s): Large structural proteinGene Names: LResearch Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV)AA Sequence:...

Recombinant Human Insulin growth factor-like family member 1 (IGFL1) | CSB-EP764932HU | CusabioAlternative Name(s): IGFL1; UNQ644/PRO1274; Insulin growth factor-like family member 1Gene Names: IGFL1Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA) | CSB-EP763968SKW | CusabioAlternative Name(s): esxA; SAS0258Type VII secretion system extracellular protein A; Ess extracellular protein AGene Names: esxAResearch...

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) | CSB-EP763937SKW | CusabioAlternative Name(s): Fur-regulated protein A Staphylococcal transferrin-binding protein A frpA, stbAGene Names: isdAResearch Areas:...

Recombinant Vespa mandarinia Vespakinin-M | CSB-EP762592VBR | CusabioAlternative Name(s): Vespakinin-MGene Names: N/AResearch Areas: OthersOrganism: Vespa mandarinia(Asian giant hornet)AA Sequence: GRPPGFSPFRIDSource: E.coliTag Info: N-terminal...

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZATa0 | CusabioAlternative Name(s): Membrane-associated protein VP40Gene Names: VP40Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZAT | CusabioAlternative Name(s): Membrane-associated protein VP40Gene Names: VP40Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Hypocrea rufa Endo-beta-1, 6-galactanase (6GAL) | CSB-EP762323THZ | CusabioAlternative Name(s): 6GALEndo-beta-1,6-galactanase; EC 3.2.1.164Gene Names: 6GALResearch Areas: OthersOrganism: Hypocrea rufa (Trichoderma viride)AA Sequence:...

Recombinant Mycobacterium paratuberculosis DNA integrity scanning protein DisA (disA) | CSB-EP762077MLA | CusabioAlternative Name(s): Cyclic di-AMP synthase (c-di-AMP synthase) (Diadenylate cyclase)Gene Names: disAResearch Areas: OthersOrganism:...

Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial | CSB-EP761ABS | CusabioAlternative Name(s): /Gene Names: NDM-1Research Areas: OthersOrganism: Acinetobacter baumanniiAA Sequence:...

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial | CSB-EP761623HU | CusabioAlternative Name(s): CD33 antigen-like 3Gene Names: SIGLEC15Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Complexin-2 (CPLX2) | CSB-EP761369HU | CusabioAlternative Name(s): Complexin IIGene Names: CPLX2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Uncharacterized aarF domain-containing protein kinase 2 (Adck2), partial | CSB-EP761222MO | CusabioAlternative Name(s): Adck2Uncharacterized aarF domain-containing protein kinase 2; EC 2.7.11.-Gene Names: Adck2Research Areas:...

Recombinant Mouse C-type lectin domain family 18 member A (Clec18a) | CSB-EP759740MO | CusabioAlternative Name(s): Mannose receptor-like protein (Mrcl) (Mrlp)Gene Names: Clec18aResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Staphylococcus aureus mRNA interferase MazF (mazF) | CSB-EP758890SUL | CusabioAlternative Name(s): Toxin MazF (mRNA interferase MazF)Gene Names: mazFResearch Areas: OthersOrganism: Staphylococcus aureus (strain MW2)AA Sequence:...

Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA) , partial | CSB-EP758331LAAD | CusabioAlternative Name(s): inlA; LMOf2365_0471; Internalin AGene Names: inlAResearch Areas: OthersOrganism: Listeria monocytogenes serotype 4b (strain...

Recombinant Human ALK and LTK ligand 1 (ALKAL1) | CSB-EP757795HU | CusabioAlternative Name(s): ALKAL1; FAM150A; UNQ9433/PRO34745ALK and LTK ligand 1; Augmentor beta; AUG-beta; Protein FAM150AGene Names: ALKAL1Research Areas: OthersOrganism: Homo sapiens...

Recombinant Arachis hypogaea Conglutin-7 | CSB-EP757666ANE | CusabioAlternative Name(s): Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2Gene Names: N/AResearch Areas: OthersOrganism: Arachis hypogaea...

Recombinant Mouse Erythroferrone (Erfe) | CSB-EP757647MO | CusabioAlternative Name(s): Complement C1q tumor necrosis factor-related protein 15 MyonectinGene Names: ErfeResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Bartonella henselae Lipoyl synthase (lipA) | CSB-EP756700BSG | CusabioAlternative Name(s): Lip-synGene Names: lipAResearch Areas: OthersOrganism: Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)AA...

Recombinant Zaire ebolavirus Minor nucleoprotein VP30 (VP30) | CSB-EP755264ZATa0 | CusabioAlternative Name(s): Transcription activator VP30Gene Names: VP30Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Zaire ebolavirus Minor nucleoprotein VP30 (VP30) | CSB-EP755264ZAT | CusabioAlternative Name(s): Transcription activator VP30Gene Names: VP30Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Human Ras association domain-containing protein 6 (RASSF6) | CSB-EP754570HU | CusabioAlternative Name(s): RASSF6; Ras association domain-containing protein 6Gene Names: RASSF6Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Isthmin-2 (ISM2) | CSB-EP753615HU | CusabioAlternative Name(s): Thrombospondin and AMOP domain-containing isthmin-like protein 1 Thrombospondin type-1 domain-containing protein 3Gene Names: ISM2Research Areas: othersOrganism: Homo...

Recombinant Staphylococcus aureus Clumping factor B (clfB) , partial | CSB-EP753442SKV | CusabioAlternative Name(s): Fibrinogen receptor B Fibrinogen-binding protein BGene Names: clfBResearch Areas: OthersOrganism: Staphylococcus aureus (strain...

Recombinant Chamaecyparis obtusa Polygalacturonase | CSB-EP752116CHAX | CusabioAlternative Name(s): Polygalacturonase; PG; EC 3.2.1.15; Major pollen allergen Cha o 2; Pectinase; allergen Cha o 2Gene Names: N/AResearch Areas: OthersOrganism: Chamaecyparis...

Recombinant Staphylococcus aureus Poly-beta-1, 6-N-acetyl-D-glucosamine N-deacetylase (icaB) | CSB-EP751939SKY | CusabioAlternative Name(s): Biofilm polysaccharide intercellular adhesin deacetylase Short name: Biofilm PIA deacetylase Intercellular...

Recombinant Staphylococcus aureus Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI (fabI) | CSB-EP750140SKV | CusabioAlternative Name(s): NADPH-dependent enoyl-ACP reductaseGene Names: fabIResearch Areas: OthersOrganism: Staphylococcus aureus (strain...

Recombinant Mouse Beta-defensin 14 (Defb14) | CSB-EP749254MO | CusabioAlternative Name(s): Defensin, beta 14Gene Names: Defb14Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence: FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKKSource: E.coliTag...

Recombinant Pseudomonas azotoformans L-amino acid amidase (laaA) | CSB-EP748477PHAE | CusabioAlternative Name(s): laaAL-amino acid amidase; EC 3.5.1.101Gene Names: laaAResearch Areas: OthersOrganism: Pseudomonas azotoformansAA Sequence:...

Recombinant Mycobacterium paratuberculosis UPF0353 protein MAP_3434 (MAP_3434), partial | CSB-EP748202MLA1 | CusabioAlternative Name(s): MAP_3434; UPF0353 protein MAP_3434Gene Names: MAP_3434Research Areas: OthersOrganism: Mycobacterium paratuberculosis...

Recombinant Human Histone H2A.V (H2AFV) | CSB-EP747894HU | CusabioAlternative Name(s): H2A.F/ZGene Names: H2AFVResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Lysobacter enzymogenes Lysyl endopeptidase | CSB-EP745349LLB | CusabioAlternative Name(s): Lys-CGene Names: N/AResearch Areas: OthersOrganism: Lysobacter enzymogenesAA Sequence:...

Recombinant Human Eukaryotic translation initiation factor 3 subunit M (EIF3M) | CSB-EP745333HU | CusabioAlternative Name(s): Short name: eIF3m Alternative name(s): Fetal lung protein B5 Short name: hFL-B5 PCI domain-containing protein 1Gene Names:...

Recombinant Plasmodium falciparum Plasmepsin-1 (PF14_0076) | CSB-EP745322EWP | CusabioAlternative Name(s): Aspartic hemoglobinase IPfAPGGene Names: PF14_0076Research Areas: OthersOrganism: Plasmodium falciparum (isolate 3D7)AA Sequence:...

Recombinant Human Protein FAM131A (FAM131A) | CSB-EP744268HU | CusabioAlternative Name(s): Gene Names: FAM131AResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Protein GPR15L (GPR15L) | CSB-EP744262HU | CusabioAlternative Name(s): Antimicrobial peptide with 57 amino acid residues (AP-57) (Antimicrobial peptide-57) (Colon-derived SUSD2 binding factor) (CSBF) (Secreted protein C10orf99)...

Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial | CSB-EP742487SRE | CusabioAlternative Name(s): Envelope glycoprotein(GP1,2)(GP) [Cleaved into: GP1; GP2; Shed GP(GP1,2-delta)]Gene Names: GPResearch Areas: OthersOrganism: Sudan ebolavirus...

Recombinant Neurospora crassa Cyanovirin-N homolog (NCU05495) | CSB-EP742424NHA | CusabioAlternative Name(s): NCU05495Cyanovirin-N homolog; CV-N homologGene Names: NCU05495Research Areas: OthersOrganism: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A...

Recombinant Human Beclin 1-associated autophagy-related key regulator (ATG14) | CSB-EP741052HU | CusabioAlternative Name(s): Autophagy-related protein 14-like protein Short name:Atg14LGene Names: ATG14Research Areas: OthersOrganism: Homo sapiens...

Recombinant Petrosia ficiformis Silicatein | CSB-EP740986PGAQ | CusabioAlternative Name(s): ; Silicatein; EC 3.4.22.-Gene Names: N/AResearch Areas: OthersOrganism: Petrosia ficiformis(Common Mediterranean sponge)AA Sequence:...

Recombinant Human ALK and LTK ligand 2 (ALKAL2) | CSB-EP740918HU | CusabioAlternative Name(s): Augmentor alpha (AUG-alpha) (FAM150B) (FAM150B)Gene Names: ALKAL2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Uncharacterized protein C19orf48 (C19orf48) | CSB-EP740850HU | CusabioAlternative Name(s): Multidrug resistance-related proteinGene Names: C19orf48Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS) | CSB-EP740005SKV | CusabioAlternative Name(s): 4'-phosphopantetheinyl transferase AcpSGene Names: acpSResearch Areas: OthersOrganism: Staphylococcus aureus (strain MRSA252)AA...

Recombinant Candida glabrata Autophagy-related protein 8 (ATG8) | CSB-EP739788CZIa2 | CusabioAlternative Name(s): Autophagy-related ubiquitin-like modifier ATG8Gene Names: ATG8Research Areas: OthersOrganism: Candida glabrata (strain ATCC 2001 / CBS 138 /...

Recombinant Candida glabrata Serine/threonine-protein kinase ATG1 (ATG1), partial | CSB-EP738902CZIa2 | CusabioAlternative Name(s): Autophagy-related protein 1Gene Names: ATG1Research Areas: OthersOrganism: Candida glabrata (strain ATCC 2001 / CBS 138 /...

Recombinant Candida glabrata Serine/threonine-protein kinase ATG1 (ATG1), partial | CSB-EP738902CZI | CusabioAlternative Name(s): Autophagy-related protein 1Gene Names: ATG1Research Areas: OthersOrganism: Candida glabrata (strain ATCC 2001 / CBS 138 /...

Recombinant Lecanicillium psalliotae Alkaline serine protease ver112 | CSB-EP737896LCAT | CusabioAlternative Name(s): Alkaline serine protease ver112; EC 3.4.21.-Gene Names: N/AResearch Areas: OthersOrganism: Lecanicillium psalliotae (Verticillium...

Recombinant Arachis hypogaea Arachin Ahy-3 | CSB-EP737391ANE | CusabioAlternative Name(s): Arachin Ahy-3 [Cleaved into: Arachin Ahy-3 chain alpha; Arachin Ahy-3 chain beta]Gene Names: N/AResearch Areas: OthersOrganism: Arachis hypogaea (Peanut)AA...

Recombinant Cat Allergen Fel d 4 | CSB-EP736184CA | CusabioAlternative Name(s): Allergen: Fel d 4Gene Names: N/AResearch Areas: OthersOrganism: Felis catus (Cat) (Felis silvestris catus)AA Sequence:...

Recombinant Human SH3 and PX domain-containing protein 2A (SH3PXD2A), partial | CSB-EP735983HU | CusabioAlternative Name(s): Adapter protein TKS5 (Five SH3 domain-containing protein) (SH3 multiple domains protein 1) (Tyrosine kinase substrate with five...

Recombinant Rickettsia typhi Probable ABC transporter permease protein RT0041 (RT0041), partial | CSB-EP734727RNE1 | CusabioAlternative Name(s): /Gene Names: RT0041Research Areas: othersOrganism: Rickettsia typhi (strain ATCC VR-144 / Wilmington)AA...

Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 (Trim21) | CSB-EP733816MO | CusabioAlternative Name(s): 52KDA Ro protein52KDA ribonucleoprotein autoantigen Ro/SS-ARo(SS-A)Sjoegren syndrome type A antigen ;SS-ATripartite motif-containing protein...

Recombinant Mouse Arginase-1 (Arg1) | CSB-EP733775MO | CusabioAlternative Name(s): Liver-type arginaseType I arginaseGene Names: Arg1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Thermus thermophilus Ribonuclease HII (rnhB) | CSB-EP732892TNT | CusabioAlternative Name(s): RNase HIIGene Names: rnhBResearch Areas: OthersOrganism: TNT-Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)AA Sequence:...

Recombinant Pongo abelii Lysosome-associated membrane glycoprotein 5 (LAMP5), partial | CSB-EP732623PYX | CusabioAlternative Name(s): Brain and dendritic cell-associated LAM (Brain-associated LAMP-like protein) (BAD-LAMP) (Lysosome-associated membrane...

Recombinant Oryza sativa subsp. japonica TPR repeat-containing thioredoxin TDX (Os09g0401200) | CSB-EP732309OFGb1 | CusabioAlternative Name(s): OsTrx26 (Tetratricoredoxin) (OsTDX)Gene Names: Os09g0401200Research Areas: OthersOrganism: Oryza sativa subsp...

Recombinant Human herpesvirus 6A Glycoprotein 105 (U96/U97/U98/U99/U100), partial | CSB-EP731651HJY | CusabioAlternative Name(s): /Gene Names: U96/U97/U98/U99/U100Research Areas: othersOrganism: Human herpesvirus 6A (strain GS) (HHV-6 variant A) (Human B...

Recombinant Mouse Cytochrome P450 3A13 (Cyp3a13) | CSB-EP731056MO | CusabioAlternative Name(s): CYPIIIA13Gene Names: Cyp3a13Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Vomeronasal secretory protein 1 (Lcn3) | CSB-EP730794MO | CusabioAlternative Name(s): Lipocalin-3 Vomeronasal secretory protein I Short name: VNSP IGene Names: Lcn3Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Streptococcus pyogenes serotype M6 50S ribosomal protein L7/L12 (rplL) | CSB-EP730328SMZ | CusabioAlternative Name(s): rplL; M6_Spy0814; 50S ribosomal protein L7/L12Gene Names: rplLResearch Areas: OthersOrganism: Streptococcus pyogenes...

Recombinant Hepatitis E virus genotype 1 Secreted protein ORF2 (ORF2), partial | CSB-EP727851HVZ | CusabioAlternative Name(s): Protein ORF2 ;pORF2Gene Names: ORF2Research Areas: OthersOrganism: Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55)...

Recombinant Symbiobacterium thermophilum DNA mismatch repair protein MutS (mutS), partial | CSB-EP727813SRW | CusabioAlternative Name(s): mutS; STH1757; DNA mismatch repair protein MutSGene Names: mutSResearch Areas: OthersOrganism: Symbiobacterium...

Recombinant Rhizobium sullae Copper-containing nitrite reductase (nirK) | CSB-EP726612RBAW | CusabioAlternative Name(s): Cu-NIRGene Names: nirKResearch Areas: othersOrganism: Rhizobium sullae (Rhizobium hedysari)AA Sequence:...

Recombinant Legionella pneumophila subsp. pneumophila Gamma-glutamyl phosphate reductase (proA) | CSB-EP726567LDL | CusabioAlternative Name(s): Gamma-glutamyl phosphate reductase(GPR)(EC 1.2.1.41)(Glutamate-5-semialdehyde...

Recombinant Human Acyl-CoA-binding domain-containing protein 5 (ACBD5), partial | CSB-EP725893HU | CusabioAlternative Name(s): Acbd5; ACBD5_HUMAN; Acyl CoA binding domain containing 5; Acyl CoA binding domain containing protein 5; Acyl Coenzyme A binding...