Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA) | CSB-EP763968SKW

(No reviews yet) Write a Review
SKU:
CSB-EP763968SKW
Availability:
13 - 23 Working Days
  • Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA) | CSB-EP763968SKW | Cusabio

Alternative Name(s): esxA; SAS0258Type VII secretion system extracellular protein A; Ess extracellular protein A

Gene Names: esxA

Research Areas: Others

Organism: Staphylococcus aureus (strain MSSA476)

AA Sequence: MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-97aa

Sequence Info: Full Length

MW: 27 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Virulence factor that is important for the establishment of infection in the host.

Reference: "Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance."Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J.Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Virulence factor that is important for the establishment of infection in the host.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: WXG100 family, sagEsxA-like subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6GCJ0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose