RecombinantMouseAquaporin-4 (Aqp4), partial | CSB-YP001964MO1

(No reviews yet) Write a Review
SKU:
CSB-YP001964MO1
Availability:
3 - 7 Working Days
  • RecombinantMouseAquaporin-4 (Aqp4), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $568.80

Description

RecombinantMouseAquaporin-4 (Aqp4), partial | CSB-YP001964MO1 | Cusabio

Alternative Name(s): Mercurial-insensitive water channel

Gene Names: Aqp4

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 253-323aa

Sequence Info: Partial

MW: 9.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Reference: "Defective secretion of saliva in transgenic mice lacking aquaporin-5 water channels." Ma T., Song Y., Gillespie A., Carlson E.J., Epstein C.J., Verkman A.S. J. Biol. Chem. 274:20071-20074(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Involvement in disease:

Subcellular Location: Membrane, Multi-pass membrane protein

Protein Families: MIP/aquaporin (TC 1.A.8) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55088

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose