Recombinant Human Aquaporin-4 (AQP4), partial | CSB-YP001964HU

Recombinant Human Aquaporin-4 (AQP4), partial | CSB-YP001964HU | Cusabio

Alternative Name(s): Mercurial-insensitive water channel ;MIWCWCH4

Gene Names: AQP4

Research Areas: Transport

Organism: Homo sapiens (Human)

AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 253-323aa

Sequence Info: Partial

MW: 10 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous syst.

Reference: Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.Ho J.D., Yeh R., Sandstrom A., Chorny I., Harries W.E., Robbins R.A., Miercke L.J., Stroud R.M.Proc. Natl. Acad. Sci. U.S.A. 106:7437-7442(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.

Involvement in disease:

Subcellular Location: Membrane, Multi-pass membrane protein

Protein Families: MIP/aquaporin (TC 1.A.8) family

Tissue Specificity: Brain - muscle >> heart, kidney, lung, and trachea.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P55087

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM