Recombinant Vaccinia virus Protein K3 (VACWR034) | CSB-BP323585VAI

Recombinant Vaccinia virus Protein K3 (VACWR034) | CSB-BP323585VAI | Cusabio

Alternative Name(s): Protein K3(Protein K2)

Gene Names: CTSK

Research Areas: Others

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

AA Sequence: MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ

Source: Baculovirus

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-88aa

Sequence Info: Full Length

MW: 11.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Viral mimic of eIF-2-alpha that acts as a pseudosubstrate for EIF2AK2/PKR kinase. Inhibits therefore eIF-2-alpha phosphorylation by host EIF2AK2/PKR kinase and prevents protein synthesis shutoff.

Reference: "Non-essential genes in the vaccinia virus HindIII K fragment: a gene related to serine protease inhibitors and a gene related to the 37K vaccinia virus major envelope antigen."Boursnell M.E.G., Foulds I.J., Campbell J.I., Binns M.M.J. Gen. Virol. 69:2995-3003(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18378

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A