Recombinant Vaccinia virus Complement control protein C3 (VACWR025) | CSB-YP302389VAI

Recombinant Vaccinia virus Complement control protein C3 (VACWR025) | CSB-YP302389VAI | Cusabio

Alternative Name(s): 28KDA protein Secretory protein 35 Short name: Protein C3 VCP

Gene Names: VACWR025

Research Areas: Microbiology

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

AA Sequence: CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-263aa

Sequence Info: Full Length of Mature Protein

MW: 28.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.

Reference: "Vaccinia virus encodes a secretory polypeptide structurally related to complement control proteins."Kotwal G.J., Moss B.Nature 335:176-178(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b.

Involvement in disease:

Subcellular Location: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Extracellular side, Secreted

Protein Families: Receptors of complement activation (RCA) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P68638

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A