Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100) | CSB-EP517681TQY

Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100) | CSB-EP517681TQY | Cusabio

Alternative Name(s): Protein CLP

Gene Names: HSP100

Research Areas: Signal Transduction

Organism: Trypanosoma cruzi

AA Sequence: NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLFRRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDEAKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMILAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-138aa

Sequence Info: Full Length

MW: 22.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Conservation of genetic linkage between heat shock protein 100 and glycosylphosphatidylinositol-specific phospholipase C in Trypanosoma brucei and Trypanosoma cruzi." Redpath M.B., Carnall N., Webb H., Courel M., Amorim A., Guther M.L.S., Cardoso de Almeida M.L., Carrington M. Mol. Biochem. Parasitol. 94:113-121(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: ClpA/ClpB family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O15885

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A