Recombinant Toxoplasma gondii Dense granule protein 6 (GRA6), partial | CSB-EP631656TOV1e0

Recombinant Toxoplasma gondii Dense granule protein 6 (GRA6), partial | CSB-EP631656TOV1e0 | Cusabio

Alternative Name(s): Antigen p32 (Protein p33)

Gene Names: GRA6

Research Areas: Others

Organism: TOV-Toxoplasma gondii

AA Sequence: NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 35-150aa

Sequence Info: Partial

MW: 38.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Major granular component involved in excreted-secreted antigen (ESA) immunity. May have a structural role in the membranous network of the parasitophorous vacuole (PV).

Reference: "Characterization of a dense granule antigen of Toxoplasma gondii (GRA6) associated to the network of the parasitophorous vacuole." Lecordier L., Moleon-Borodowsky I., Dubremetz J.-F., Tourvieille B., Mercier C., Deslee D., Capron A., Cesbron-Delauw M.-F. Mol. Biochem. Parasitol. 70:85-94(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q27003

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A