Recombinant Sulfolobus islandicus Chromatin protein Cren7 (creN7) | CSB-EP502491FPB

(No reviews yet) Write a Review
SKU:
CSB-EP502491FPB
Availability:
13 - 23 Working Days
  • Recombinant Sulfolobus islandicus Chromatin protein Cren7 (creN7)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Sulfolobus islandicus Chromatin protein Cren7 (creN7) | CSB-EP502491FPB | Cusabio

Alternative Name(s): creN7; LS215_1335Chromatin protein Cren7

Gene Names: creN7

Research Areas: Others

Organism: Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)

AA Sequence: MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-60aa

Sequence Info: Full Length

MW: 33.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.

Reference: Biogeography of the Sulfolobus islandicus pan-genome.Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.Proc. Natl. Acad. Sci. U.S.A. 106:8605-8610(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Cren7 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: C3MPN0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose