Cusabio Virus & Bacteria Recombinants
Recombinant Sulfolobus islandicus Chromatin protein Cren7 (creN7) | CSB-EP502491FPB
- SKU:
- CSB-EP502491FPB
- Availability:
- 13 - 23 Working Days
Description
Recombinant Sulfolobus islandicus Chromatin protein Cren7 (creN7) | CSB-EP502491FPB | Cusabio
Alternative Name(s): creN7; LS215_1335Chromatin protein Cren7
Gene Names: creN7
Research Areas: Others
Organism: Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
AA Sequence: MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-60aa
Sequence Info: Full Length
MW: 33.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.
Reference: Biogeography of the Sulfolobus islandicus pan-genome.Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.Proc. Natl. Acad. Sci. U.S.A. 106:8605-8610(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Cren7 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: C3MPN0
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A