Recombinant Streptomyces sp. L-proline cis-3-hydroxylase 2 | CSB-EP520960FOM

(No reviews yet) Write a Review
SKU:
CSB-EP520960FOM
Availability:
13 - 23 Working Days
€352.00 - €1,702.00

Description

Recombinant Streptomyces sp. L-proline cis-3-hydroxylase 2 | CSB-EP520960FOM | Cusabio

Alternative Name(s): L-proline cis-3-hydroxylase 2(P3H 2)(EC 1.14.11.28)(Proline 3-hydroxylase 2)(Proline 3-hydroxylase type II)

Gene Names: N/A

Research Areas: Others

Organism: Streptomyces sp.

AA Sequence: MRSHILGKIELDQTRLAPDLAYLAAVPTVEEEYDEFSNGFWKHVPLWNASGDSEDRLYRDLKDAAAQPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNLKNAIVIPHRDFVELDREVDRYFRTFMVLEDSPLAFHSNEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVDFAFDGPFDEKEIFADATLYAPGSTPDLPERRPFTAEHRRRILSLGQVIERENFRDILFLLSKVHYKYDVHPSETYDWLIEISKQAGDEKMVVKAEQIRDFAVEARALSERFSLTSW

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-290aa

Sequence Info: Full Length

MW: 44.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Dioxygenase that catalyzes the 2-oxoglutarate-dependent selective hydroxylation of free L-proline to cis-3-hydroxy-L-proline (cis-3-Hyp).

Reference: "Cloning of an isozyme of proline 3-hydroxylase and its purification from recombinant Escherichia coli." Shibasaki T., Mori H., Ozaki A. Biotechnol. Lett. 22:1967-1973(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O09345

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose