Cusabio Staphylococcus aureus Recombinants
Recombinant Staphylococcus aureus Staphopain B (sspB) | CSB-EP859203SKX
- SKU:
- CSB-EP859203SKX
- Availability:
- 3 - 7 Working Days
Description
Recombinant Staphylococcus aureus Staphopain B (sspB) | CSB-EP859203SKX | Cusabio
Alternative Name(s): Staphylococcal cysteine proteinase BStaphylopain B
Gene Names: sspB
Research Areas: Others
Organism: Staphylococcus aureus (strain Mu50 / ATCC 700699)
AA Sequence: DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 220-393aa
Sequence Info: Full Length of Mature Protein
MW: 46.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other Extracellular domain proteases is involved in colonization and infection of human tissues .
Reference: Genetic characterization of staphopain genes in Staphylococcus aureus.Golonka E., Filipek R., Sabat A., Sinczak A., Potempa J.Biol. Chem. 385:1059-1067(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other extracellular proteases is involved in colonization and infection of human tissues (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Peptidase C47 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q99V46
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A