Recombinant Staphylococcus aureus Staphopain B (sspB) | CSB-EP859203SKX

Recombinant Staphylococcus aureus Staphopain B (sspB) | CSB-EP859203SKX | Cusabio

Alternative Name(s): Staphylococcal cysteine proteinase BStaphylopain B

Gene Names: sspB

Research Areas: Others

Organism: Staphylococcus aureus (strain Mu50 / ATCC 700699)

AA Sequence: DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 220-393aa

Sequence Info: Full Length of Mature Protein

MW: 46.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other Extracellular domain proteases is involved in colonization and infection of human tissues .

Reference: Genetic characterization of staphopain genes in Staphylococcus aureus.Golonka E., Filipek R., Sabat A., Sinczak A., Potempa J.Biol. Chem. 385:1059-1067(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other extracellular proteases is involved in colonization and infection of human tissues (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase C47 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99V46

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A