Cusabio Ovis aries Recombinants
Recombinant Sheep Beta-2-microglobulin (B2M) | CSB-EP002486SH
- SKU:
- CSB-EP002486SH
- Availability:
- 3 - 7 Working Days
Description
Recombinant Sheep Beta-2-microglobulin (B2M) | CSB-EP002486SH | Cusabio
Alternative Name(s): B2MBeta-2-microglobulin
Gene Names: B2M
Research Areas: Cancer
Organism: Ovis aries (Sheep)
AA Sequence: IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 21-118aa
Sequence Info: Full Length of Mature Protein
MW: 18.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system
Reference: "Ovine beta-2 microglobulin." O'Brien R., Berger S., Griffin F. Submitted (FEB-2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Beta-2-microglobulin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q6QAT4
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A