Recombinant Sheep Beta-2-microglobulin (B2M) | CSB-EP002486SH

(No reviews yet) Write a Review
SKU:
CSB-EP002486SH
Availability:
3 - 7 Working Days
  • Recombinant Sheep Beta-2-microglobulin (B2M)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $1,053.60

Description

Recombinant Sheep Beta-2-microglobulin (B2M) | CSB-EP002486SH | Cusabio

Alternative Name(s): B2MBeta-2-microglobulin

Gene Names: B2M

Research Areas: Cancer

Organism: Ovis aries (Sheep)

AA Sequence: IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-118aa

Sequence Info: Full Length of Mature Protein

MW: 18.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system

Reference: "Ovine beta-2 microglobulin." O'Brien R., Berger S., Griffin F. Submitted (FEB-2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Beta-2-microglobulin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6QAT4

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose