Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1) | CSB-EP522580SXVb1

(No reviews yet) Write a Review
SKU:
CSB-EP522580SXVb1
Availability:
3 - 7 Working Days
  • Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Schizosaccharomyces pombe Glucan endo-1, 3-alpha-glucosidase agn1 (agn1) | CSB-EP522580SXVb1 | Cusabio

Alternative Name(s): Endo-1,3-alpha-glucanase agn1

Gene Names: agn1

Research Areas: Others

Organism: SchizosaccharoMyces pombe (strain 972 / ATCC 24843) (Fission yeast)

AA Sequence: DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRPTPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSGVPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTGVLYF

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-424aa

Sequence Info: Full Length of Mature Protein

MW: 51.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides.

Reference: "A functional genome-wide genetic screening identifies new pathways controlling the G1/S transcriptional wave." Gaspa L., Gonzalez-Medina A., Hidalgo E., Ayte J. Cell Cycle 15:720-729(2016)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has a role in cell separation where it is required for the degradation of the cell wall material surrounding the septum (the septum edging) which must be hydrolyzed before full separation of the daughter cells can occur. Hydrolyzes 1,3-alpha-glucan predominantly into pentasaccharides.

Involvement in disease:

Subcellular Location: Secreted, Secreted, cell wall

Protein Families: Glycosyl hydrolase 71 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O13716

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose