Recombinant Salmonella typhimurium Protein PrgJ (prgJ) | CSB-YP331347SXBa4

(No reviews yet) Write a Review
SKU:
CSB-YP331347SXBa4
Availability:
25 - 35 Working Days
  • Recombinant Salmonella typhimurium Protein PrgJ (prgJ)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,076.00

Description

Recombinant Salmonella typhimurium Protein PrgJ (prgJ) | CSB-YP331347SXBa4 | Cusabio

Alternative Name(s): prgJ; STM2872Protein PrgJ

Gene Names: prgJ

Research Areas: Others

Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

AA Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 1-101aa

Sequence Info: Full Length

MW: 26.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for invasion of epithelial cells.

Reference: "PhoP/PhoQ transcriptional repression of Salmonella typhimurium invasion genes: evidence for a role in protein secretion." Pegues D.A., Hantman M.J., Behlau I., Miller S.I. Mol. Microbiol. 17:169-181(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for invasion of epithelial cells.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P41785

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose