Cusabio Salmonella typhimurium Recombinants
Recombinant Salmonella typhimurium Protein PrgJ (prgJ) | CSB-YP331347SXBa4
- SKU:
- CSB-YP331347SXBa4
- Availability:
- 25 - 35 Working Days
Description
Recombinant Salmonella typhimurium Protein PrgJ (prgJ) | CSB-YP331347SXBa4 | Cusabio
Alternative Name(s): prgJ; STM2872Protein PrgJ
Gene Names: prgJ
Research Areas: Others
Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
AA Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Source: Yeast
Tag Info: N-terminal 6xHis-sumostar-tagged
Expression Region: 1-101aa
Sequence Info: Full Length
MW: 26.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Required for invasion of epithelial cells.
Reference: "PhoP/PhoQ transcriptional repression of Salmonella typhimurium invasion genes: evidence for a role in protein secretion." Pegues D.A., Hantman M.J., Behlau I., Miller S.I. Mol. Microbiol. 17:169-181(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Required for invasion of epithelial cells.
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P41785
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A