Recombinant Rat Peripheral myelin protein 22 (Pmp22) | CSB-CF018241RA

(No reviews yet) Write a Review
SKU:
CSB-CF018241RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Peripheral myelin protein 22 (Pmp22)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£1,026.40 - £1,724.00

Description

Recombinant Rat Peripheral myelin protein 22 (Pmp22) | CSB-CF018241RA | Cusabio

Alternative Name(s): Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)

Gene Names: Pmp22

Research Areas: Neuroscience

Organism: Rattus norvegicus (Rat)

AA Sequence: MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-160aa

Sequence Info: Full Length

MW: 23.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Reference: "Axon-regulated expression of a Schwann cell transcript that is homologous to a 'growth arrest-specific' gene." Spreyer P., Kuhn G., Hanemann C.O., Gillen C., Schaal H., Kuhn R., Lemke G., Mueller H.W. EMBO J. 10:3661-3668(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein

Protein Families: PMP-22/EMP/MP20 family

Tissue Specificity: Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25094

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose