Recombinant Rat Glandular kallikrein-7, submandibular/renal (Klk7) | CSB-EP012458RA

Recombinant Rat Glandular kallikrein-7, submandibular/renal (Klk7) | CSB-EP012458RA | Cusabio

Alternative Name(s): Esterase BKallikrein-related protein K1;Proteinase ARSKG-7Tissue kallikrein

Gene Names: Klk7

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: VIGGYKCEKNSQPWQVALYSFTKYLCGGVLIDPSWVITAAHCSSNNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPDYKPFLMRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLIWEFPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLCDGVLQGITSWGSVPCAKTNMPAIYTKLIKFTSWIKEVMKENP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-261aa

Sequence Info: Full Length of Mature Protein

MW: 30.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.

Reference: The expression of two kallikrein gene family members in the rat kidney.Brady J.M., MacDonald R.J.Arch. Biochem. Biophys. 278:342-349(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Predominant kallikrein protein in the kidney.

Involvement in disease:

Subcellular Location:

Protein Families: Peptidase S1 family, Kallikrein subfamily

Tissue Specificity: Kidney and submandibular gland. Not expressed in liver, pancreas, spleen, parotid, testis, cortex, prostate, ovary and pituitary.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P36373

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A