Cusabio Rattus norvegicus Recombinants
Recombinant Rat Galectin-4 (Lgals4) | CSB-EP012889RAe1
- SKU:
- CSB-EP012889RAe1
- Availability:
- 3 - 7 Working Days
Description
Recombinant Rat Galectin-4 (Lgals4) | CSB-EP012889RAe1 | Cusabio
Alternative Name(s): L-36 lactose-binding protein Short name: L36LBP Lactose-binding lectin 4
Gene Names: Lgals4
Research Areas: Others
Organism: Rattus norvegicus (Rat)
AA Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Source: E.coli
Tag Info: Tag-Free
Expression Region: 1-324aa
Sequence Info: Full Length
MW: 36.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Galectin that binds lactose and a related range of sugars.
Reference: "Soluble lactose-binding lectin from rat intestine with two different carbohydrate-binding domains in the same peptide chain."Oda Y., Herrmann J., Gitt M., Turck C.W., Burlingame A.L., Barondes S.H., Leffler H.J. Biol. Chem. 268:5929-5939(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Galectin that binds lactose and a related range of sugars.
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity: Highly expressed in full-length form in small and large intestine and stomach but was not detected in other tissues including lung, liver, kidney and spleen.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P38552
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A