Recombinant Rat Galectin-3 (Lgals3) | CSB-EP012887RA

(No reviews yet) Write a Review
SKU:
CSB-EP012887RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Galectin-3 (Lgals3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Rat Galectin-3 (Lgals3) | CSB-EP012887RA | Cusabio

Alternative Name(s): 35KDA lectin Carbohydrate-binding protein 35

Gene Names: Lgals3

Research Areas: Neuroscience

Organism: Rattus norvegicus (Rat)

AA Sequence: ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-262aa

Sequence Info: Full Length of Mature Protein

MW: 31.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. In the nucleus: acts as a pre-mRNA splicing factor. Involved in acute inflammatory responses including neutrophil activation and adhesion, chemoattraction of monocytes macrophages, opsonization of apoptotic neutrophils, and activation of mast cells. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during early embryogenesis.

Reference: "An IgE-binding protein with a distinctive repetitive sequence and homology with an IgG receptor." Albrandt K., Orida N.K., Liu F.-T. Proc. Natl. Acad. Sci. U.S.A. 84:6859-6863(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. In the nucleus

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus, Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08699

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose