Recombinant Raphanus sativus Defensin-like protein 2 (AFP2) | CSB-EP339081RJP

(No reviews yet) Write a Review
SKU:
CSB-EP339081RJP
Availability:
3 - 7 Working Days
  • Recombinant Raphanus sativus Defensin-like protein 2 (AFP2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Raphanus sativus Defensin-like protein 2 (AFP2) | CSB-EP339081RJP | Cusabio

Alternative Name(s): Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2

Gene Names: AFP2

Research Areas: Others

Organism: Raphanus sativus (Radish)

AA Sequence: QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 30-80aa

Sequence Info: Full Length of Mature Protein

MW: 21.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake.

Reference: "Mutational analysis of a plant defensin from radish (Raphanus sativus L.) reveals two adjacent sites important for antifungal activity." De Samblanx G.W., Goderis I.J., Thevissen K., Raemaekers R., Fant F., Borremans F., Acland D.P., Osborn R.W., Patel S., Broekaert W.F. J. Biol. Chem. 272:1171-1179(1997).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K(+) efflux and Ca(2+) uptake.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: DEFL family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P30230

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose