Cusabio Virus & Bacteria Recombinants
Recombinant Raphanus sativus Defensin-like protein 2 (AFP2) | CSB-EP339081RJP
- SKU:
- CSB-EP339081RJP
- Availability:
- 3 - 7 Working Days
Description
Recombinant Raphanus sativus Defensin-like protein 2 (AFP2) | CSB-EP339081RJP | Cusabio
Alternative Name(s): Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2
Gene Names: AFP2
Research Areas: Others
Organism: Raphanus sativus (Radish)
AA Sequence: QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 30-80aa
Sequence Info: Full Length of Mature Protein
MW: 21.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake.
Reference: "Mutational analysis of a plant defensin from radish (Raphanus sativus L.) reveals two adjacent sites important for antifungal activity." De Samblanx G.W., Goderis I.J., Thevissen K., Raemaekers R., Fant F., Borremans F., Acland D.P., Osborn R.W., Patel S., Broekaert W.F. J. Biol. Chem. 272:1171-1179(1997).
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K(+) efflux and Ca(2+) uptake.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: DEFL family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P30230
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A