Cusabio Pseudomonas aeruginosa Recombinants
Recombinant Pseudomonas aeruginosa PA-I galactophilic lectin (lecA) | CSB-EP313124EZX
- SKU:
- CSB-EP313124EZX
- Availability:
- 3 - 7 Working Days
Description
Recombinant Pseudomonas aeruginosa PA-I galactophilic lectin (lecA) | CSB-EP313124EZX | Cusabio
Alternative Name(s): Galactose-binding lectin
Gene Names: lecA
Research Areas: Others
Organism: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
AA Sequence: AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 2-122aa
Sequence Info: Full Length of Mature Protein
MW: 16.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hagglutinating activity.
Reference: The Pseudomonas aeruginosa lectins PA-1L and PA-2L are controlled by quorum sensing and by RpoS.Winzer K., Falconer C., Diggle S.P., Garber N.C., Camara M., Williams P.Complete genome sequence of Pseudomonas aeruginosa PAO1, an opportunistic pathogen.Stover C.K., Pham X.-Q.T., Erwin A.L., Mizoguchi S.D., Warrener P., Hickey M.J., Brinkman F.S.L., Hufnagle W.O., Kowalik D.J., Lagrou M., Garber R.L., Goltry L., Tolentino E., Westbrock-Wadman S., Yuan Y., Brody L.L., Coulter S.N., Folger K.R. , Kas A., Larbig K., Lim R.M., Smith K.A., Spencer D.H., Wong G.K.-S., Wu Z., Paulsen I.T., Reizer J., Saier M.H. Jr., Hancock R.E.W., Lory S., Olson M.V.Nature 406:959-964(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: D-galactose specific lectin. Binds in decreasing order of affinity
Involvement in disease:
Subcellular Location: Cytoplasm, Periplasm, Cell surface
Protein Families: LecA/PllA lectin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q05097
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A