Cusabio Pseudomonas aeruginosa Recombinants
Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL) | CSB-EP875877EZX
- SKU:
- CSB-EP875877EZX
- Availability:
- 3 - 7 Working Days
Description
Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL) | CSB-EP875877EZX | Cusabio
Alternative Name(s): Protease IVPvdS-regulated endoprotease
Gene Names: prpL
Research Areas: Others
Organism: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
AA Sequence: AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 212-462aa
Sequence Info: Full Length of Mature Protein
MW: 42.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Lysine-specific endoprotease . Involved in corneal virulence.
Reference: Identification of the active site residues of Pseudomonas aeruginosa protease IV. Importance of enzyme activity in autoprocessing and activation.Traidej M., Marquart M.E., Caballero A.R., Thibodeaux B.A., O'Callaghan R.J.J. Biol. Chem. 278:2549-2553(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Lysine-specific endoprotease
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Peptidase S1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9HWK6
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A