Recombinant Potato leafroll virus Major capsid protein (ORF3) | CSB-EP325916PQU

Recombinant Potato leafroll virus Major capsid protein (ORF3) | CSB-EP325916PQU | Cusabio

Alternative Name(s): Coat protein Short name: CP

Gene Names: ORF3

Research Areas: Microbiology

Organism: Potato leafroll virus (strain Potato/Canada/Rowhani/1979) (PLrV)

AA Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-208aa

Sequence Info: Full Length

MW: 27.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Major capsid protein.

Reference: "Identification and characterization of the potato leafroll virus putative coat protein gene."Kawchuk L.M., Martin R.R., Rochon D.M., McPherson J.J. Gen. Virol. 70:783-788(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major capsid protein.

Involvement in disease:

Subcellular Location: Virion

Protein Families: Luteoviruses capsid protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17521

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A