Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39) | CSB-EP327448LRP

(No reviews yet) Write a Review
SKU:
CSB-EP327448LRP
Availability:
3 - 7 Working Days
  • Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39) | CSB-EP327448LRP | Cusabio

Alternative Name(s): P39; Major capsid protein

Gene Names: P39

Research Areas: Others

Organism: Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV)

AA Sequence: MALVSGALSTNRLRNYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIEKMVLPIPDAEGNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTHMIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFNRTSAILAMTNPRRYCSQVNSNYARIWTTDDVNVAGNVFESMPPFLKNLINVAVAPEQIMIDEKTLVIRNCPTCNIDDSGLVANVQLYNPVVPRYRSTFNENVLHVENVLKFKGNANALQKSLSRYEPYPIVVPLMLGTQTLNTSSAYKQFTVPTRDDFAALNQRTGAAAAAPPAPAAAPAGPRPAAELEYDETLDRFARWRAR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-356aa

Sequence Info: Full Length

MW: 44.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Expressed late in infection.

Reference: "Nucleotide sequence of the p39-capsid gene region of the Lymantria dispar nuclear polyhedrosis virus." Bjoernson R.M., Rohrmann G.F. J. Gen. Virol. 73:1505-1508(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Virion

Protein Families: Baculoviridae p39 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35840

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose