Cusabio Other Organism Recombinants
Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39) | CSB-EP327448LRP
- SKU:
- CSB-EP327448LRP
- Availability:
- 3 - 7 Working Days
Description
Recombinant Lymantria dispar multicapsid nuclear polyhedrosis virus Major capsid protein (P39) | CSB-EP327448LRP | Cusabio
Alternative Name(s): P39; Major capsid protein
Gene Names: P39
Research Areas: Others
Organism: Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV)
AA Sequence: MALVSGALSTNRLRNYCVFGAVQPFDNCRAYGSPCSPDSTNNDGWFICDYHSSIRFKIEKMVLPIPDAEGNIYNRTVGKSLVNHKTLGAARVLIPTRDNYKTVLNLNSMSLAEQLVTHMIYDNVEAQGAVCKALQHNENFQTETYRLAEDMFNRTSAILAMTNPRRYCSQVNSNYARIWTTDDVNVAGNVFESMPPFLKNLINVAVAPEQIMIDEKTLVIRNCPTCNIDDSGLVANVQLYNPVVPRYRSTFNENVLHVENVLKFKGNANALQKSLSRYEPYPIVVPLMLGTQTLNTSSAYKQFTVPTRDDFAALNQRTGAAAAAPPAPAAAPAGPRPAAELEYDETLDRFARWRAR
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-356aa
Sequence Info: Full Length
MW: 44.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Expressed late in infection.
Reference: "Nucleotide sequence of the p39-capsid gene region of the Lymantria dispar nuclear polyhedrosis virus." Bjoernson R.M., Rohrmann G.F. J. Gen. Virol. 73:1505-1508(1992)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Virion
Protein Families: Baculoviridae p39 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P35840
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A