Recombinant Plasmodium falciparum Merozoite surface antigen 2 (MSA2), partial | CSB-EP343481EWP

(No reviews yet) Write a Review
SKU:
CSB-EP343481EWP
Availability:
13 - 23 Working Days
  • Recombinant Plasmodium falciparum Merozoite surface antigen 2 (MSA2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Plasmodium falciparum Merozoite surface antigen 2 (MSA2), partial | CSB-EP343481EWP | Cusabio

Alternative Name(s): 45KDA merozoite surface antigen

Gene Names: MSA2

Research Areas: Others

Organism: Plasmodium falciparum (isolate 3D7)

AA Sequence: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 109-246aa

Sequence Info: Partial

MW: 41.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in the merozoite attachment to the erythrocyte.

Reference: Structural diversity in the 45-kilodalton merozoite surface antigen of Plasmodium falciparum.Smythe J.A., Peterson M.G., Coppel R.L., Saul A.J., Kemp D.J., Anders R.F.Mol. Biochem. Parasitol. 39:227-234(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in the merozoite attachment to the erythrocyte.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P50498

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose