Cusabio Plasmodium falciparum Recombinants
Recombinant Plasmodium falciparum Merozoite surface antigen 2 (MSA2), partial | CSB-YP343481EWP
- SKU:
- CSB-YP343481EWP
- Availability:
- 25 - 35 Working Days
Description
Recombinant Plasmodium falciparum Merozoite surface antigen 2 (MSA2), partial | CSB-YP343481EWP | Cusabio
Alternative Name(s): 45KDA merozoite surface antigen
Gene Names: MSA2
Research Areas: Others
Organism: Plasmodium falciparum (isolate 3D7)
AA Sequence: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 109-246aa
Sequence Info: Partial
MW: 16.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May play a role in the merozoite attachment to the erythrocyte.
Reference: Structural diversity in the 45-kilodalton merozoite surface antigen of Plasmodium falciparum.Smythe J.A., Peterson M.G., Coppel R.L., Saul A.J., Kemp D.J., Anders R.F.Mol. Biochem. Parasitol. 39:227-234(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May play a role in the merozoite attachment to the erythrocyte.
Involvement in disease:
Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P50498
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A