Recombinant Oryza sativa subsp. japonica TPR repeat-containing thioredoxin TDX (Os09g0401200) | CSB-EP732309OFGb1

(No reviews yet) Write a Review
SKU:
CSB-EP732309OFGb1
Availability:
3 - 7 Working Days
$422.40 - $1,053.60

Description

Recombinant Oryza sativa subsp. japonica TPR repeat-containing thioredoxin TDX (Os09g0401200) | CSB-EP732309OFGb1 | Cusabio

Alternative Name(s): OsTrx26 (Tetratricoredoxin) (OsTDX)

Gene Names: Os09g0401200

Research Areas: Others

Organism: Oryza sativa subsp. japonica (Rice)

AA Sequence: MATAGASSFEDEIMESDIELEGEAVEPDNDPPQKMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKLDEAIEHLTEAIVLNPTSAIAYATRAVIFVKSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEIGAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEEVSAASAALKDGDVIAIHSSSELDTKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAEKHRNVVFLKVDIDELNSVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-317aa

Sequence Info: Full Length

MW: 42.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats

Reference: "Comparative genomic study of the thioredoxin family in photosynthetic organisms with emphasis on Populus trichocarpa." Chibani K., Wingsle G., Jacquot J.P., Gelhaye E., Rouhier N. Mol. Plant 2:308-322(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-81?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 5? for up to one week.

Function: Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families: Thioredoxin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6ES52

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose