Recombinant Onchocerca volvulus OV-16 antigen (OV16) | CSB-YP341251OEG

(No reviews yet) Write a Review
SKU:
CSB-YP341251OEG
Availability:
25 - 35 Working Days
  • Recombinant Onchocerca volvulus OV-16 antigen (OV16)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Onchocerca volvulus OV-16 antigen (OV16) | CSB-YP341251OEG | Cusabio

Alternative Name(s): OV16; OV-16 antigen

Gene Names: OV16

Research Areas: Others

Organism: Onchocerca volvulus

AA Sequence: KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 17-197aa

Sequence Info: Full Length of Mature Protein

MW: 22 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Identification of an Onchocerca volvulus cDNA encoding a low-molecular-weight antigen uniquely recognized by onchocerciasis patient sera.Lobos E., Altmann M., Mengod G., Weiss N., Rudin W., Karam M.Mol. Biochem. Parasitol. 39:135-146(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Phosphatidylethanolamine-binding protein family

Tissue Specificity: Hypodermis, cuticle and uterus.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31729

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose