Recombinant Human Sperm-associated antigen 16 protein (SPAG16) | CSB-EP818674HU

Recombinant Human Sperm-associated antigen 16 protein (SPAG16) | CSB-EP818674HU | Cusabio

Alternative Name(s): Pf20 protein homolog

Gene Names: SPAG16

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-183aa

Sequence Info: Full Length of Isoform 4

MW: 47.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia

Reference: "A sperm-associated WD repeat protein orthologous to Chlamydomonas PF20 associates with Spag6, the mammalian orthologue of Chlamydomonas PF16." Zhang Z., Sapiro R., Kapfhamer D., Bucan M., Bray J., Chennathukuzhi V., McNamara P., Curtis A., Zhang M., Blanchette-Mackie E.J., Strauss J.F. III Mol. Cell. Biol. 22:7993-8004(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By similarity).

Involvement in disease:

Subcellular Location: Cytoplasm, Cytoplasm, cytoskeleton, flagellum axoneme, Cytoplasm, cytoskeleton, cilium axoneme

Protein Families:

Tissue Specificity: Isoform 1 is detected in testis. Isoform 4 is detected in testis and brain, and at lower levels in kidney, heart, pancreas, thyroid, ovary, adrenal gland, spinal cord, trachea and liver.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8N0X2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM