Recombinant Neisseria meningitidis serogroup C Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) | CSB-EP434696NEW

(No reviews yet) Write a Review
SKU:
CSB-EP434696NEW
Availability:
3 - 7 Working Days
€352.00 - €1,702.00

Description

Recombinant Neisseria meningitidis serogroup C Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) | CSB-EP434696NEW | Cusabio

Alternative Name(s): Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase(UDP-N-acetylglucosamine acyltransferase)(EC 2.3.1.129)

Gene Names: lpxA

Research Areas: Others

Organism: Neisseria meningitidis serogroup C (strain 053442)

AA Sequence: MTLIHPTAVIDPKAELDSSVKVGAYTVIGPNVQIGANTEIGPHAVINGHTSIGENNRIFQFASLGEIPQDKKYRDEPTRLIIGNGNTIREFTTFNLGTVTGIGETRIGDDNWIMAYCHLAHDCVVGNHTIFANNASLAGHVTIGDYVVLGGYTLVFQFCRIGDYAMTAFAAGVHKDVPPYFMASGYRAEPAGLNSEGMRRNGFTAEQISAVKDVYKTLYHRGIPFEEAKADILRRAETQAELAVFRDFFAQSARGIIR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-258aa

Sequence Info: Full Length

MW: 34.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.

Reference: "Characterization of ST-4821 complex, a unique Neisseria meningitidis clone." Peng J., Yang L., Yang F., Yang J., Yan Y., Nie H., Zhang X., Xiong Z., Jiang Y., Cheng F., Xu X., Chen S., Sun L., Li W., Shen Y., Shao Z., Liang X., Xu J., Jin Q. Genomics 91:78-87(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A9M3T0

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose